|
|
||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MEMBRANE TRANSPORTERS, ION CHANNELS, AND PUMPS
Laboratory of Membrane Biochemistry, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, Okayama, Japan
Submitted 24 February 2006 ; accepted in final form 14 April 2006
| ABSTRACT |
|---|
|
|
|---|
cells of the islets of Langerhans, Leydig cells, and vitamin A-storing Ito cells. These results indicate that mMATE1 is a polyspecific H+/OC exchanger. The unexpectedly wide distribution of mMATE1 suggests involvement of this transporter protein in diverse biological functions other than excretion of OCs from the body. multidrug and toxin extrusion; multidrug transport; hydrophobic cation
The multidrug and toxin extrusion (MATE) family is the most recently identified multidrug resistance-conferring protein family in bacteria (3, 11, 23). Although the overall properties of the MATE family are not yet elucidated, some MATE-type proteins mediate H+- or Na+/cationic drugs exchange (3, 11, 23). Very recently, our laboratory identified the human and mouse orthologs of MATE1 (20). Human MATE1 (hMATE1) is predominantly expressed in kidney and liver. When expressed in HEK-293 cells, hMATE1 is localized in the plasma membrane and mediates electroneutral H+/tetraethylammonium (TEA) and H+/1,4-methylphenylpyridinium (MPP) exchange. Furthermore, in cis-inhibition studies, hMATE1 was shown to exhibit a substrate specificity similar to that of renal OC export, and thus it was concluded that hMATE1 is responsible for the final step of excretion of OCs through kidney and liver.
To establish the concept that MATE1 is generally responsible for the final step of excretion of OCs in mammals, we decided to study the expression, localization, and function of MATE1 counterpart in mice (mMATE1). Such studies are also important from a comparative aspect, because many previous studies on renal and hepatic OC excretion have been carried out in mice or mouse specimens.
In the present study, we have shown that mMATE1 mediates electroneutral H+/TEA exchange and that the substrate specificity is similar to that of hMATE1. Furthermore, we have found that mMATE1 is widely distributed throughout body, especially in epithelial cells and secretory cells.
| MATERIALS AND METHODS |
|---|
|
|
|---|
RT-PCR analysis. Total RNA (1 µg) extracted from isolated organs from wild-type ddY and C57BL/6 mice was transcribed into cDNA in 20 µl of reaction buffer containing 0.2 mM each dNTP, 10 mM dithiothreitol, 100 pmol of random octamers, and 200 units of Moloney murine leukemia virus reverse transcriptase (Amersham). After 1 h of incubation at 42°C, the reaction was terminated by heating at 90°C for 5 min. For PCR amplification, the cDNA solution was added to a PCR buffer, which contained 0.6 mM total dNTP (150 µM each dNTP), 25 pmol of primers, and 1.5 units of AmpliTaq Gold DNA polymerase (PerkinElmer). Thirty-five temperature cycles were conducted. Each cycle comprised denaturation at 94°C for 30 s, annealing at 56°C for 30 s, and extension at 72°C for 1 min. The amplification products were analyzed with polyacrylamide gel electrophoresis. The primers used were based on the database sequence (GenBank accession no. BC031436) 5'-CCTTCAGGCTTCAGTGTGGCT-3' (nucleotides 960980) and antisense primer 5'-ATGCCTCGAGTTATTGCTGTCCTTTGGACGG-3' (nucleotides 16141644). No amplified products were obtained without the RT reaction products. DNA sequencing was performed using the chain termination method (24).
mMATE1-expressing cells. cDNA encoding mMATE1 was subcloned into the expression vector pcDNA3.1(+) (Invitrogen). This plasmid, pcDNA/mMATE1, was used to transfect HEK-293 cells by lipofection using TransIT reagent (Mirus). HEK-293 cells were grown in Dulbecco's modified Eagle's medium (DMEM) containing 10% fetal calf serum, penicillin, and streptomycin at 37°C under 5% CO2 as described previously (20). Twenty-four hours later, 1.5 x 106 cells per 10-cm dish were transfected with 10 µg of pcDNA3.1/mMATE1. For selection of cells that stably express mMATE1, the cells were grown for 2 days in the presence of 400 µg/ml geneticin. Colonies expressing mMATE1 were selected by means of immunohistochemistry and the transport assay described below.
Transport assay. After selection with geneticin, mMATE1-expressing cells were harvested and suspended in transport assay medium (125 mM NaCl, 4.8 mM KCl, 5.6 mM D-glucose, 1.2 mM CaCl2, 1.2 mM KH2PO4, 1.2 mM MgSO4, and 25 mM Tricine, pH 8.0). Cells were incubated at 37°C for 5 min; the transport assay was initiated by adding 50 µM radiolabeled TEA (5 kBq/assay; PerkinElmer Life Science) as described previously (20). At appropriate times, aliquots of the mixture (200 µl) were filtered through 0.45-µm type HA membrane filters (Millipore). Each filter was washed with 5 ml of ice-cold medium, and the radioactivity remaining on the filter was counted. Amounts of TEA taken up by the cells were expressed as nanomoles per milligram of total cell protein.
Antibodies. Site-specific rabbit polyclonal antibodies against mMATE1 were prepared by repeated injections of glutathione S-transferase fusion polypeptides encoding amino acid residues P495Q532 of mMATE1 (PESHGEIMMTDLEKKRRDSVGPADEPATSFAYPSKGQQ). Immunological specificity was investigated and described previously (20). The following antibodies were used as cell markers. Mouse monoclonal antibodies against glucagon, insulin, or serotonin were obtained from Sigma, Progen, or NeoMarkers, respectively. Rabbit polyclonal antibodies against gastrin and rat monoclonal antibodies against somatostatin were obtained from Chemicon. Guinea pig polyclonal antibodies against rat pancreatic polypeptide and PYY were from Linco Research. Alexa Fluor 488-labeled anti-rabbit IgG and Alexa Fluor 568-labeled anti-mouse IgG were purchased from Molecular Probes.
Western blot analysis.
Total membrane fractions of mouse ddY or C57BL/6 tissues (
0.11 g wet weight depending on the organ) were isolated, suspended in ice-cold 20 mM MOPS-Tris, pH. 7.0, containing 0.3 M sucrose, 5 mM EDTA, and protease inhibitors (pepstatin A, leupeptin, antipain, and chymostatin at 10 µg/ml each), homogenized, and centrifuged at 800 g for 8 min at 4°C. The postnuclear supernatant was then centrifuged at 100,000 g for 1 h at 4°C. The pellet was suspended in the same buffer and denatured at room temperature for 30 min in the presence of 1% SDS and 10%
-mercaptoethanol. Samples (40300 µg of protein) were subjected to electrophoresis and Western blot analysis as described previously (20). As a positive control, mMATE1 was expressed in sf9 cells transfected with recombinant baculovirus containing cloned mMATE1 (20).
Immunohistochemistry. Immunohistochemical analysis was performed using indirect immunofluorescence microscopy as described previously (10). In brief, male ddY mice were anesthetized with ether and then perfused intracardially with saline, followed by 4% paraformaldehyde in 0.1 M phosphate buffer (pH 7.4). The organs were isolated, and frozen sections were prepared. In the case of cultured cells, cells on poly-L-lysine-coated coverslips were fixed with 4% paraformaldehyde in phosphate-buffered saline (PBS) for 30 min. After being washed with PBS, the specimens were incubated for either 20 min (cells) or 30 min (organs) in the same buffer containing 0.1% Triton X-100, followed by PBS containing 2% goat serum and 0.5% bovine serum albumin. The specimens were incubated with antibodies diluted to 1 µg/ml or 1,000-fold (anti-mMATE1 or other antibody) with PBS containing 0.5% bovine serum albumin for 1 h at room temperature. Samples were washed four times with PBS and then reacted with the secondary antibody or Alexa Fluor 568-labeled anti-mouse IgG (1 µg/ml) or Alexa Fluor 488-labeled anti-rabbit IgG (2 µg/ml) for 1 h at room temperature. Finally, the immunoreactivity was examined under either an Olympus BX60 microscope or an Olympus FV300 confocal laser microscope.
| RESULTS |
|---|
|
|
|---|
|
|
|
50-kDa immunological counterpart in crude membrane fractions of the heart, stomach, small intestine, bladder, thyroid gland, adrenal gland, and testes, indicating the presence of mMATE1 at the protein level in these organs (Fig. 3B). In contrast, an immunoreactive polypeptide was not detected in the membrane fraction of brain, indicating that content of mMATE1 in this organ is either below the detection limit of our system or is degraded by proteases (Fig. 3B).
|
|
cells. The pancreatic polypeptide also partly colocalized with mMATE1, indicating that a population of pancreatic F cells expressed mMATE1 (Fig. 5, GI). In testes, mMATE1 is specifically present in Leydig cells (Fig. 5J). Finally, we found that Ito cells, liver-specific pericytes that store vitamin A (8), also contained strong mMATE1 immunoreactivity (Fig. 6).
|
|
| DISCUSSION |
|---|
|
|
|---|
The most important finding of the study is that MATE1 is expressed and localized in various tissues other than kidney and liver. Among the organs tested, mMATE1 transcript was not detected in the submandibular gland and pancreas (data not shown), even though mMATE1-positive cells are present in these organs (Figs. 4 and 5). This may be due to degradation of RNA during preparation, given that both organs contain high levels of RNases.
The combined immunohistochemical and molecular biological approaches revealed that mMATE1-expressing cells can be classified into three categories. The first is epithelial cells surrounding internal cavities. We have shown that mMATE1 is expressed in brain capillaries and pancreatic duct cells as well as epithelial cells of the urinary bladder. This suggests that MATE1-mediated excretion of OCs occurs in these MATE1-expressing cells in addition to the urinary tract and bile canaliculi. Striated duct in the glandula submandibularis and auxiliary cells in the stomach also belong to this category. In other words, excretion of toxic OCs, that is metabolic wastes, may occur in all organs in which MATE1 is present. Because MATE1 is an H+/OC exchanger, a slightly acidic pH (
66.5) extracellular environment is necessary to drive excretion. Thus the extracellular pH near MATE1-expressing cells is somehow made acidic, probably through vacuolar H+-ATPases and/or Na+/H+ antiporters. In rodent kidney and bladder, such an acidic environment for the excretion of OCs can be achieved by vacuolar H+-ATPase at plasma membrane (2, 29).
The second category includes certain type of endocrine cells in the stomach, small intestine, and islets of Langerhans. The pancreas and the gastrointestinal tract contain more than 18 types of endocrine cells (26). We have ascertained that
cells and F cells contain mMATE1. These cells are known to secrete peptide hormones and/or transmitters through exocytosis. Although the true function of mMATE1 in these cells is not known, it is possible that these endocrine cells extrude physiologically important cationic transmitters through MATE1-mediated transport.
More interestingly, the third category of MATE1-expressing cells store or secrete hydrophobic hormones and vitamins. Ito cells store vitamin A. Leydig cells synthesize and secrete testosterone. The cells of the adrenal cortex synthesize and secrete corticosterones and follicle cells in thyroid gland secrete thyroxine. On the basis of results of cis-inhibition of TEA transport (Table 1), we suggest that MATE1 is responsible for secretion of these steroid hormones through the plasma membrane. It should be stressed that the molecular mechanism of secretion of steroid hormones remains unknown.
Thus, although further studies are necessary, it appears that the function of mammalian MATE-type transporters is not limited to the excretion of OCs but also may have a role in the homeostasis of electrolytes through efficient and regulated transportation/release of physiological metabolites of various sizes, structures, and hydrophobicity. This possibility is now under investigation in our laboratory.
It is quite likely that the resistance to drugs and endogenous toxic metabolites observed in plants can be attributed to their MATE homologs (4, 5, 18, 33). The observation that both mMATE1 and hMATE1 seem to recognize quercetin as a transport substrate (Table 1) is consistent with the idea that quercetin may be transported into plant vacuoles through a MATE-type transporter (4). Our results support the conservative and ubiquitous nature of the MATE superfamily as a polyspecific OC exporter and its wide variety of roles in the excretion or sequestration of OCs and related compounds.
| GRANTS |
|---|
|
|
|---|
| ACKNOWLEDGMENTS |
|---|
| FOOTNOTES |
|---|
The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
| REFERENCES |
|---|
|
|
|---|
2. Brown D and Breton S. H+V-ATPase-dependent luminal acidification in the kidney collecting duct and the epididymis/vas deferens: vesicle recycling and transcytotic pathways. J Exp Biol 203: 147154, 2000.[Abstract]
3. Brown MH, Paulsen IT, and Skurray RA. The multidrug efflux protein NorM is a prototype of a new family of transporters. Mol Microbiol 31: 394395, 1999.[CrossRef][Web of Science][Medline]
4. Debeaujon I, Peeters AJ, Leon-Kloosterziel KM, and Koornneef M. The TRANSPARENT TESTA12 gene of Arabidopsis encodes a multidrug secondary transporter-like protein required for flavonoid sequestration in vacuoles of the seed coat endothelium. Plant Cell 13: 853871, 2001.
5. Diener AC, Gaxiola RA, and Fink GR. Arabidopsis ALF5, a multidrug efflux transporter gene family member, confers resistance to toxins. Plant Cell 13: 16251638, 2001.
6. Enomoto A, Kimura H, Chairoungdua A, Shigeta Y, Jutabha P, Cha SH, Hosoyamada M, Takeda M, Sekine T, Igarashi T, Matsuo H, Kikuchi Y, Oda T, Ichida K, Hosoya T, Shimokata K, Niwa T, Kanai Y, and Endou H. Molecular identification of a renal urate anion exchanger that regulates blood urate levels. Nature 417: 447452, 2002.[Medline]
7. Fei YJ, Kanai Y, Nussberger S, Ganapathy V, Leibach FH, Romero MF, Singh SK, Boron WF, and Hediger MA. Expression cloning of a mammalian proton-coupled oligopeptide transporter. Nature 368: 563566, 1994.[CrossRef][Medline]
8. Geerts A. History, heterogeneity, developmental biology, and functions of quiescent hepatic stellate cells. Semin Liver Dis 21: 311335, 2001.[CrossRef][Web of Science][Medline]
9. Grundemann D, Gorboulev V, Gambaryan S, Veyhl M, and Koepsell H. Drug excretion mediated by a new prototype of polyspecific transporter. Nature 372: 549552, 1994.[CrossRef][Medline]
10. Hayashi M, Morimoto R, Yamamoto A, and Moriyama Y. Expression and localization of vesicular glutamate transporters in pancreatic islets, upper gastrointestinal tract, and testis. J Histochem Cytochem 51: 13751390, 2003.
11. Hvorup RN, Winnen B, Chang AB, Jiang Y, Zhou XF, and Saier MH Jr. The multidrug/oligosaccharidyl-lipid/polysaccharide (MOP) exporter superfamily. Eur J Biochem 270: 799813, 2003.[Web of Science][Medline]
12. Inui KI, Masuda S, and Saito H. Cellular and molecular aspects of drug transport in the kidney. Kidney Int 58: 944958, 2000.[CrossRef][Web of Science][Medline]
13. Jacquemin E, Hagenbuch B, Stieger B, Wolkoff AW, and Meier PJ. Expression cloning of a rat Na+-independent organic anion transporter. Proc Natl Acad Sci USA 91: 133137, 1994.
14. Keppler D, Cui Y, Konig J, Leier I, and Nies A. Export pumps for anionic conjugates encoded by MRP genes. Adv Enzyme Regul 39: 237246, 1999.[CrossRef][Web of Science][Medline]
15. Koepsell H. Organic cation transporters in intestine, kidney, liver, and brain. Annu Rev Physiol 60: 243266, 1998.[CrossRef][Web of Science][Medline]
16. Koepsell H. Polyspecific organic cation transporters: their functions and interactions with drugs. Trends Pharmacol Sci 25: 375381, 2004.[CrossRef][Medline]
17. Morita Y, Kodama K, Shiota S, Mine T, Kataoka A, Mizusima T, and Tsuchiya T. NorM, a putative multidrug efflux protein, of Vibrio parahaemolyticus and its homolog in Escherichia coli. Antimicrob Agents Chemother 42: 17781782, 1998.
18. Nawrath C, Heck S, Parinthawong N, and Metraux JP. EDS5, an essential component of salicylic acid-dependent signaling for disease resistance in Arabidopsis, is a member of the MATE transporter family. Plant Cell 14: 275286, 2002.
19. Otsuka M, Yasuda M, Morita Y, Otsuka C, Tsuchiya T, Omote H, and Moriyama Y. Identification of essential amino acid residues of the NorM Na+/multidrug antiporter in Vibrio parahaemolyticus. J Bacteriol 187: 15521558, 2005.
20. Otsuka M, Matsumoto T, Morimoto R, Omote H, and Moriyama Y. A human transporter protein that mediates the final excretion step for toxic organic cations. Proc Natl Acad Sci USA 102: 1792317928, 2005.
21. Oude Elferink RP, Meijer DK, Kuipers F, Jansen PL, Groen AK, and Groothuis GM. Hepatobiliary secretion of organic compounds; molecular mechanisms of membrane transport. Biochim Biophys Acta 1241: 215268, 1995.[Medline]
22. Pritchard JB and Miller DS. Mechanisms mediating renal secretion of organic anions and cations. Physiol Rev 73: 765796, 1993.
23. Putman M, van Veen HW, and Konings WN. Molecular properties of bacterial multidrug transporters. Microbiol Mol Biol Rev 64: 672693, 2000.
24. Sambrook J and Russell DW. Molecular CloningA Laboratory Manual. Cold Spring Harbor: Cold Spring Harbor Laboratory, 1989.
25. Sekine T, Watanabe N, Hosoyamada M, Kanai Y, and Endou H. Expression cloning and characterization of a novel multispecific organic anion transporter. J Biol Chem 272: 1852618529, 1997.
26. Solcia E, Capella C, Buffa R, Usellini L, Fiocca R, and Sessa F. Endocrine cells of the digestive systems. In: Physiology of the Gastrointestinal Tract (2nd ed.), edited by Johnson LR. New York: Raven, 1987, p. 111130.
27. Sweet DH, Wolff NA, and Pritchard JB. Expression cloning and characterization of ROAT1. The basolateral organic anion transporter in rat kidney. J Biol Chem 272: 3008830095, 1997.
28. Tamai I, Yabuuchi H, Nezu J, Sai Y, Oku A, Shimane M, and Tsuji A. Cloning and characterization of a novel human pH-dependent organic cation transporter, OCTN1. FEBS Lett 419: 107111, 1997.[CrossRef][Web of Science][Medline]
29. Tomochika K, Shinoda S, Kumon H, Mori M, Moriyama Y, and Futai M. Vacuolar-type proton ATPase in mouse bladder is responsible for urinary acidification. FEBS Lett 404: 6164, 1997.[CrossRef][Web of Science][Medline]
30. Ullrich KJ. Specificity of transporters for "organic anions" and "organic cations" in the kidney. Biochim Biophys Acta 1197: 4562, 1994.[Medline]
31. Ullrich KJ. Affinity of drugs to the different renal transporters for organic anions and organic cations. In: Membrane Transporters as Drug Targets, edited by Amidon GL and Sadee W. New York: Kluwer Academic/Plenum, 1999.
32. Wright SH and Dantzler WH. Molecular and cellular physiology of renal organic cation and anion transport. Physiol Rev 84: 9871049, 2004.
33. Yazaki K. Transporters of secondary metabolites. Curr Opin Plant Biol 8: 301307, 2005.[CrossRef][Web of Science][Medline]
This article has been cited by other articles:
![]() |
M. Tsuda, T. Terada, T. Mizuno, T. Katsura, J. Shimakura, and K.-i. Inui Targeted Disruption of the Multidrug and Toxin Extrusion 1 (Mate1) Gene in Mice Reduces Renal Secretion of Metformin Mol. Pharmacol., June 1, 2009; 75(6): 1280 - 1286. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Matsushima, K. Maeda, K. Inoue, K.-y. Ohta, H. Yuasa, T. Kondo, H. Nakayama, S. Horita, H. Kusuhara, and Y. Sugiyama The Inhibition of Human Multidrug and Toxin Extrusion 1 Is Involved in the Drug-Drug Interaction Caused by Cimetidine Drug Metab. Dispos., March 1, 2009; 37(3): 555 - 559. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. A. Reisman, R. L. Yeager, M. Yamamoto, and C. D. Klaassen Increased Nrf2 Activation in Livers from Keap1-Knockdown Mice Increases Expression of Cytoprotective Genes that Detoxify Electrophiles more than those that Detoxify Reactive Oxygen Species Toxicol. Sci., March 1, 2009; 108(1): 35 - 47. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Matsumoto, T. Kanamoto, M. Otsuka, H. Omote, and Y. Moriyama Role of glutamate residues in substrate recognition by human MATE1 polyspecific H+/organic cation exporter Am J Physiol Cell Physiol, April 1, 2008; 294(4): C1074 - C1078. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Hiasa, T. Matsumoto, T. Komatsu, H. Omote, and Y. Moriyama Functional characterization of testis-specific rodent multidrug and toxic compound extrusion 2, a class III MATE-type polyspecific H+/organic cation exporter Am J Physiol Cell Physiol, November 1, 2007; 293(5): C1437 - C1444. [Abstract] [Full Text] [PDF] |
||||
![]() |
X. Zhang, N. J. Cherrington, and S. H. Wright Molecular identification and functional characterization of rabbit MATE1 and MATE2-K Am J Physiol Renal Physiol, July 1, 2007; 293(1): F360 - F370. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Tsuda, T. Terada, J.-i. Asaka, M. Ueba, T. Katsura, and K.-i. Inui Oppositely directed H+ gradient functions as a driving force of rat H+/organic cation antiporter MATE1 Am J Physiol Renal Physiol, February 1, 2007; 292(2): F593 - F598. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| Visit Other APS Journals Online |