|
|
||||||||
INVITED REVIEW
Department of Physiology, Campus Gasthuisberg, Katholieke Universiteit Leuven, 3000 Leuven, Belgium
| ABSTRACT |
|---|
|
|
|---|
-phorbols, and several endogenous substances including arachidonic acid (AA), the endocannabinoids anandamide and 2-AG, and cytochrome P-450 metabolites of AA, such as epoxyeicosatrienoic acids. This review summarizes data on TRPV4 as a paradigm of gating diversity in this subfamily of Ca2+ entry channels. transient receptor potential; calcium channels; vanilloid receptor
| THE TRPV SUBFAMILY |
|---|
|
|
|---|
TRPV1 is an outwardly rectifying cation-selective ion channel with a preference for calcium (PCa/PNa
10) and magnesium (PMg/PNa
5) (9), which depends on a single aspartic acid residue in the pore region of the protein (23). TRPV1 is also activated by moderate heat (
43°C) and low pH (
5.9) and may act as an integrator of chemical and physical pain-eliciting stimuli. Gating by heat is direct, whereas mild acidosis (pH < 5.9) reduces the temperature threshold for activation and potentiates the responses to capsaicin (9, 30, 81). Capsaicin and the plant toxin resiniferatoxin are potent exogenous agonists of the vanilloid receptor (77). Endogenous agonists include the cannabinoid receptor agonist anandamide (arachidonoylethanolamide, AEA) and several eicosanoid products of lipoxygenases including 12-(S)- and 15-(S)-hydroperoxyeicosatetraenoic acids, 5-(S)-hydroxyeicosatetraenoic acid, and leukotriene B4 (34, 66, 72, 105). TRPV1 mediates nociception and contributes to the detection and integration of diverse chemical and thermal stimuli (7).
TRPV2 (VRL-1), which is 50% identical to TRPV1, is insensitive to capsaicin and low pH and has a higher threshold for activation by heat (
52°C) (8).
TRPV3, the last member of the TRPV family to be cloned, is thermosensitive in the physiological temperature range of 22 to 40°C (60, 73, 101).
TRPV4 (OTRPC4, VRL-2, VR-OAC, and TRP12) was first described as a channel activated by hypotonicity-induced cell swelling (42, 55, 74, 99), but it might, as discussed below in more detail, integrate a large variety of stimuli.
TRPV5 (ECaC1, CaT2) and the highly homologous TRPV6 (ECaC2, CaT1) were identified via an expression cloning strategy screening for Ca2+ influx-promoting genes in Xenopus oocytes, using cDNA libraries from rabbit distal tubule kidney cells and rat duodenum, respectively. Both proteins share
80% homology at the amino acid level (6165), are functionally very similar, and are able to form functional heterotetramers (32). TRPV5 and TRPV6 are highly Ca2+ selective (PCa/PNa > 100) and display anomalous mole fraction behavior, Mg2+ block, and Ca2+-dependent feedback inhibition (54, 8688). All these properties are linked to a single negatively charged aspartic acid residue in the pore region (D542 in TRPV5, D541 in TRPV6) (56).
| TRPV4: STRUCTURE AND EXPRESSION |
|---|
|
|
|---|
|
|
|
TRPV4 is expressed in a broad range of tissues, including lung, spleen, kidney, testis, fat, brain, cochlea, skin, smooth muscle, liver, and vascular endothelium (10, 18, 37, 42, 74, 99). In situ hybridization in the brain indicates expression, in the lamina terminalis of the mouse brain, in neurons of the arched vascular organ of the lamina terminalis, in the median preoptic area, the optic chiasm, neurons of the subfornical organ, the ventral hippocampal commissure, anterior hypothalamic structures, ependymal cells of the choroid plexus in the lateral ventricles, and dorsal root ganglia (DRG) neurons (14, 42, 74). Interestingly, TRPV4 mRNA but not the protein could be detected in the soma of DRG neurons, suggesting that there might exist a mechanism for the transport of the TRPV4 protein from the neuronal bodies to the sensory terminals (26). Direct functional measurement of endogenous TRPV4-mediated Ca2+ entry and/or whole cell currents have been described so far only for endothelial cells (94, 96, 97), keratinocytes (10), and DRG neurons (2).
| TRPV4: FUNCTIONAL HALLMARKS |
|---|
|
|
|---|
-phorbol 12,13-didecanoate (4
PDD) activates a large current in TRPV4-expressing cells (Fig. 3, AC), which is transient in the presence of Ca2+ (Fig. 3A) and shows a complex time course comprising potentiation, subsequent inhibition by higher [Ca2+]i, and desensitization of the agonist response (see below). In the absence of Ca2+, the current decays more slowly (Fig. 3, DF). Clearly resolvable inward currents can be measured with Ca2+ or Mg2+ as the only permeating extracellular cation, demonstrating that both divalent cations can permeate TRPV4 channels. Permeability values relative to Na+ are 610 for Ca2+ and 23 for Mg2+ (42, 55, 74, 75, 91, 94). Current-voltage relationships display slight outward rectification in the presence of extracellular Ca2+ and reverse at a positive potential. Outward rectification is also evident at the single-channel level (Fig. 4). Single-channel conductance is 90100 pS for outward currents and 5060 pS for inward currents (74, 75, 96, 97). Ruthenium red (RR) reversibly inhibits inward but not outward currents (Fig. 3, GI).
|
|
| THE TRPV4 PORE |
|---|
|
|
|---|
Figure 5 shows an amino acid sequence alignment of the putative pore regions of the six mammalian TRPV channels, illustrating the high sequence conservation for TRPV14. Interestingly, there is also significant homology with the residues in and surrounding the selectivity filter of the KcsA potassium channel, the so-called K+ channel "signature sequence" (TXXTXGYGD) (17, 103). The sequence similarities may indicate conserved pore structures for these cation channels. The GYG motif in the pore of the K+-selective channel is changed into a GMG motif for TRPV1, -2, and -4 and a GLG motif for TRPV3. This difference between TRPV1, -2, and -4 on one hand and TRPV3 on the other hand might explain the remarkably higher single-channel conductance of TRPV3 (172 pS at +60 mV vs.
100 pS for TRPV1, -2 and -4) (101).
The aspartate residue D682 is an important determinant of the Ca2+ sensitivity of the TRPV4 pore (Fig. 6). Neutralizing this aspartate to alanine causes a moderate reduction of the relative permeability for divalent cations and of the degree of outward rectification, without significantly altering monovalent permeability. Neutralizing D672 has only minor effects, whereas neutralization of both aspartates causes a much stronger reduction of Ca2+ permeability and channel rectification than D682 alone and shifts the permeability sequence for monovalent cations from Eisenman IV to I. Moreover, neutralizing D682 but not D672 strongly reduces the channel's affinity for RR (Fig. 7). In contrast, neutralization of the only positively charged residue in the putative pore region, K675, has no obvious effects on the properties of the TRPV4 channel pore. Interestingly, a mutation to M680 in the region of the K+ channel signature sequence, which is likely an equivalent of the GYG motif in K+ channels, strongly reduces whole cell current amplitude and impairs Ca2+ permeation. Therefore, it is reasonable to speculate that these mutated residues form part of the TRPV4 selectivity filter and that the architecture of the TRPV4 pore is comparable to that of K+ channels.
|
|
| ACTIVATION MECHANISMS |
|---|
|
|
|---|
PDD acts as a robust and direct channel activator. This phorbol ester, which has only weak PKC-activating potency (ED50 > 25 µM) and does not activate TRPV1 or other TRPV channels, is the most potent known activator of TRPV4 with an ED50 of 200400 nM (94). The phorbol 12,13-didecanoate 20-homovanillate phorbol-vanillate (PDDHV), a potent activator of TRPV1 (78), fails to activate TRPV4 channels in inside-out patches. However, PDDHV activates TRPV4 currents in whole cell recordings and also increases [Ca2+]i, suggesting that its vanillyl moiety has to be cleaved by intracellular esterases (Watanabe H, Vriens J, and Nilius B, unpublished observations). The TRPV4 current activated by 4
PDD is transient, and repetitive applications result in decreased responses, indicative of desensitization. The classic PKC activator phorbol 12-myristate 13-acetate (PMA), which is structurally similar to 4
PDD, displays a 10- to 50-fold lower potency than 4
PDD in activating TRPV4 channels (94). These data strongly suggest that 4
PDD acts via a mechanism distinct from the classic interaction of a phorbol 12,13-diester with a phorbol ester/diacylglycerol-type receptor target. The 4
configuration is apparently not essential for channel activation, because 4
PDD also activates TRPV4 in a similar concentration range (Watanabe H and Nilius B, unpublished observation; see also Fig. 8). TRPV4 does not contain a typical cysteine-rich phorbol-binding site, homologous to the C1 domains described for PKC and "nonkinase" phorbol ester receptors (40), and it is therefore unlikely that activation results from binding of 4
PDD to such a site. In addition, the region of best alignment with several PKCs, chimerins, and MUNC13 has very low homology and is located in the pore region (650H-699C), which makes it unlikely that phorbols are bound via a known motif to TRPV4.
|
Endogenous TRPV4 agonists. The potent activation of TRPV4 by 4
PDD fueled the search for possible endogenous TRPV4 agonists. Endocannabinoids are a class of endogenous lipids, including amides and esters of long-chain polyunsaturated fatty acids (15, 16, 45) that activate metabotropic cannabinoid receptors. The endocannabinoid anandamide (AEA) and the metabolite 12-hydroxyeicosatetraenoic acid are potent activators of TRPV1 (27, 72, 82, 104, 105). Recently, AEA and its metabolite arachidonic acid (AA) were found to cause a robust increase in intracellular Ca2+ and activate typical whole cell currents in TRPV4-expressing cells (96). AEA and the related endocannabinoid 2-arachydonyl glycerol (2-AG) (45) are transported into the cell through the action of a membrane transporter and degraded via a lipoxygenase. AEA is hydrolyzed to AA exclusively by fatty acid amidohydrolase (FAAH) (13, 15), whereas 2-AG can also be hydrolyzed through monoacylglycerol lipase and other esterases (84). Methanandamide, a nonmetabolizable analog of AEA, is not able to activate TRPV4, and phenylmethylsulfonyl fluoride, a selective FAAH inhibitor, inhibits the effects of AEA but not of AA, indicating that FAAH-dependent hydrolysis of AEA to AA is required for TRPV4 activation (96). Surprisingly, AA is not able to activate TRPV4 in cell free patches, indicating that cellular metabolism of AA is required for channel activation. ETYA, a nonspecific blocker of all AA-metabolizing enzymes (19, 71), prevents activation of TRPV4 currents by AA, which indicates that lipoxygenase (LOX), cyclooxygenase (COX), and cytochrome P-450 (CYP) metabolites of AA might act as potential activators of TRPV4 (96). Activation of TRPV4 by AA was insensitive to indomethacin, nordihydroguaiaretic acid, and a combination of these inhibitors, which ruled out an involvement of the COX and LOX pathways. Miconazole, an inhibitor of P-450 epoxygenase, and 17-octadecynoic acid (17-ODYA), an inhibitor of the P-450 epoxygenase and
/
-1-hydroxylases (71), both fully abolished the AA activation of TRPV4 (96). Importantly, the CYP inhibitors ETYA, miconazole, and 17-ODYA do not directly inhibit TRPV4 channels, because they can still be activated by 4
PDD in the presence of these blockers. Given that 5',6'-epoxyeicosatrienoic acid (EET) and, to a lesser extent, 8',9'-EET activate TRPV4 in a membrane-delimited fashion, it is most likely that the epoxygenase pathway is involved in TRPV4 activation. Thus AEA and AA apparently act as endogenous chemical agonists of TRPV4, activating the channels through CYP-dependent formation of 5',6'-EET (96). It is unclear whether these endogenous ligands can directly bind to the channel. Activation of TRPM2 by AA depends on an ISXXTKE arachidonate recognition sequence (ARS) (28) that was first shown to be important for AA signaling in the two-pore-domain potassium channel TREK-1 (58). Such an ARS-like sequence, LSRKFKD, is present at the TRPV4 COOH-terminal end of the NH2 terminus (amino acids 402408 in mTRPV4). Its role in the activation of TRPV4 is unclear because the corresponding deletion mutant could not be functionally expressed (Vriens J, Prenen J, and Nilius B, unpublished observations).
TRPV4 activation by osmosensation and mechanical stimuli. Senses based on mechanosensation include hearing and balance mediated by mechanosensors of the inner ear hair cells and cutaneous touch sensation via the terminals of sensory cells that innervate the skin (22). Changes in cell volume affect other mechanosensors, e.g., osmosensitive neurosensory cells in the circumventricular organs measure the osmolality of the blood and communicate with neurosecretory cells, leading to the secretion of antidiuretic hormone (6). TRPV4 can be activated by exposing cells to hypotonicity, implying that this channel might be a cellular osmosensor (42, 55, 74, 99). The expression of TRPV4 in epithelial cells of kidney, in the stria vascularis of the cochlea, in sweat glands, and in the osmosensory cells of the brain's circumventricular organs (14, 26, 42, 51, 74), is in agreement with such an osmosensor function.
Presently, the mechanism whereby swelling activates TRPV4 is not yet fully solved. The NH2-terminal intracellular domain of TRPV4 contains three or more ankyrin repeat domains that seem to be involved in responses to physical challenges, because TRPV4 activation is delayed if these ankyrin repeats are lacking (42) (Vriens J and Nilius B, unpublished observations). These repeats may anchor the channel to the cytoskeleton and form a mechanical link for gating. A different mechanism of hypotonicity-induced activation of TRPV4 proceeding via the phosphorylation of TRPV4 has been proposed recently (100). These authors observed in a heterologous expression model and in native murine distal convoluted tubule cells in culture a rapid cell swelling-induced tyrosine phosphorylation of TRPV4 mediated via a Lyn kinase-dependent phosphorylation of residue Y253 in the first ankyrin binding repeat. Mutation of this site abolished the hypotonicity-dependent activation of TRPV4. This mechanism is, however, controversial. We did not observe any effect on the swelling-induced response in the Y253F mutant (91a). An alternative possibility could be that hypotonic activation of TRPV4 acts through the above-described AA-EET-dependent pathway, downstream of swelling-induced, PLA2-dependent AA release (3, 59).
Activation by heat. An emerging characteristic of TRPV channels is their distinct response to changes in temperature. TRPV1 is activated at temperatures above 42°C and shows a slight sensitization during repeated stimulations (8, 38). The temperature threshold for TRPV3 activation is about 39°C, but this channel shows strong sensitization during repetitive heat challenges (60, 73, 101). TRPV4 is activated at temperatures above
27°C. In contrast to TRPV1 and TRPV3, it desensitizes upon repeated heat applications (26, 97). When constantly exposed to 37°C, TRPV4 can still respond to increased temperatures, i.e., its shows incomplete desensitization (26). Likely, TRPV4 is constitutively active at body temperature. Ca2+-dependent inactivation is a possible adaptive mechanism to reduce channel open probability by the resulting increase in [Ca2+]i (94, 95) (see also Modulation by Ca2+). The mechanism of heat activation of TRPV4 is unclear. However, the observation that heat in contrast to, for example, 4
PDD or 5',6'-EET does not activate TRPV4 channels in cell-free inside-out patches (10, 95) argues against direct activation and points to an indirect or messenger-mediated mechanism.
Modulation by Ca2+. Intracellular Ca2+ is an important regulator of TRPV4 channels and, depending on the concentration, either potentiates or inhibits channel activity (75, 94, 95). Stimulation with 4
PDD activates TRPV4 current with a certain latency, followed by inactivation. This decay is accelerated by increasing the extracellular Ca2+ concentration and is delayed in the absence of extracellular Ca2+. The ED50 for intracellular Ca2+-dependent inactivation of TRPV4 is
400600 nM (94, 95), but the nature of this Ca2+-dependent negative feedback mechanism has not yet been identified. Inactivation in the presence of extracellular Ca2+ was much slower in a mutant channel with a point mutation in the sixth transmembrane domain (F707A) (95).
An increase in intracellular Ca2+ was shown to first stimulate TRPV4 (75), and TRPV4 currents stimulated by hypotonic solutions or phorbol esters were strongly reduced at all potentials in the absence of extracellular Ca2+. The permeant divalent cations Ba2+ and Sr2+ were less effective than Ca2+ in potentiating TRPV4. This effect depended on an intracellular site in the COOH terminus, to which calmodulin binds in a Ca2+-dependent manner. This site, however, does not affect inactivation. A positively charged
-helical stretch VGRLRRDRWSSVVPRVV, similar to the COOH-terminal Ca2+/calmodulin-binding motif in TRPV6 and with some similarity to the PKC pseudosubstrate site (52), has been identified in the COOH terminal of TRPV4 starting at position 814 (75). By mutagenesis, it has been shown that this motif is the structural determinant of Ca2+-dependent potentiation (75). The same site seems essential for the spontaneous opening of TRPV4 channels in the absence of any agonist (75). This spontaneous activation might be responsible for the observed elevated Ca2+ levels in nonstimulated TRPV4-expressing cells (42, 74, 96, 97, 99). Interestingly, mutant channels with a single mutation in the COOH terminus of TRPV4 (E797) were constitutively open, i.e., spontaneous activation seemed to be increased (95), suggesting that this site may interfere with Ca2+ binding at the neighboring calmodulin-binding motif.
Modulation by phosphorylation. The mechanism of TRPV1 activation and potentiation by PKC-dependent phosphorylation has been investigated in detail (39, 57, 67, 85). It has recently been shown that PMA, a known activator of PKC, also activates TRPV4 (21). Concentrations of PMA that are subthreshold at room temperature (94) activate TRPV4 at 37°C through a PKC-dependent pathway. The PMA activation of TRPV4 is dramatically reduced in the presence of the PKC inhibitors calphostin C and staurosporine (21), indicating that phorbols activate TRPV4 via PKC-independent and -dependent mechanisms. The potentiating effect of PKC stimulation on TRPV4 activation by other stimuli, such as endogenous agonists, cell swelling, and heat, has not yet been studied in detail. Putative PKC phosphorylation sites are indicated in Fig. 1. Probably, S88, S134, and S528 are the most likely candidates for mediating functional effects.
Remarkably, modulation by lipids, such as phosphatidylinositol 4,5-bisphosphate (PIP2), is still completely unknown for TRPV4. The COOH terminus of TRPV1 contains a modular PIP2 binding site (a cluster of basic residues interspersed by hydrophobic amino acids, e.g., LRSSRVSGRHWKNFALVPLLREASARDRQSAQPEEVYLRQFSS for hTRPV1). Binding of PIP2 to this site causes tonic inhibition of the channels, and PLC-mediated hydrolysis sensitizes the channel for activation by capsaicin, protons, and heat (68). This site, however, is not conserved in TRPV4, but all TRPV4s contain a low-homology site with six basic amino acids between residues 400 and 446 whose possible functional impact is still unknown.
Interference of various stimuli. TRPV4 is coexpressed with TRPV3 in mouse keratinocytes (10). Heat responses were significantly enhanced under hypotonic conditions and inhibited under hypertonic conditions in these cells. 4
PDD also augmented the responsiveness to heat, i.e., a concentration of 4
PDD that is subthreshold at room temperature activates TRPV4 at higher temperatures (10, 21). Similar synergistic effects have also been observed for the responses of TRPV1 channels to capsaicin, heat, and protons.
TRPV4 expressed in human embryonic kidney (HEK) cells also clearly shows this stimulus interdependence of activation. At room temperature, activation by hypotonic cell swelling, shear stress, and PKC is modest or absent, but 4
PDD induces a clear effect. At elevated temperatures (37°C), TRPV4 is rapidly activated by all stimuli. Temperature appears to be a critical modulator of TRPV4 channel gating, leading to activation of the channel by a diverse range of microenvironmental chemical and physical signals (21). It is obvious from these data that the precise threshold for TRPV4 activation depends on the cellular context and environmental history of the channel. Activity-dependent changes in channel state, channel phosphorylation, or dephosphorylation (100); changes in osmolarity; activation of downstream signaling pathways; and protein-protein interactions such as heteromultimeric channel formation may all cause diversity in activation parameters. Heat does not affect the 5',6'-EET-induced increase in [Ca2+]i, but this increase is reduced under hyposmotic conditions (Vriens J and Nilius B, unpublished data). Likely, the heat-sensitive pathway is different from the swelling-induced pathway.
| POSSIBLE PHYSIOLOGICAL FUNCTIONS FOR TRPV4 |
|---|
|
|
|---|
Keratinocytes are capable of detecting modest temperature elevations, which contribute to warmth perception and/or cutaneous thermoregulation. In a recent study, strong evidence was provided for an involvement of TRPV4 in these responses (10). In addition to peripheral temperature sensing, TRPV4 might also play a role in regulating thermogenesis. TRPV4 is expressed in the preoptic and anterior hypothalamus (26, 42), the control center of thermogenesis that contains specialized warm- and cool-sensitive neurons, which are also activated by hyposmolarity (1, 5, 33, 83). The high level of TRPV4 expression in endothelial cells (94, 97) may hint to another role in thermoregulation by influencing the vasomotor activity of peripheral vessels. The involvement of TRPV4 in thermosensation and thermoregulation might become clearer in mice lacking TRPV4.
The basal level of TRPV4 activity at normal body temperature will undoubtedly contribute to Ca2+ homeostasis and might influence the growth and differentiation state of cells expressing TRPV4. Primary keratinocytes maintain an undifferentiated proliferative phenotype at low extracellular Ca2+, whereas exposure to higher Ca2+ inhibits proliferation, changes cell morphology and induces terminal differentiation (10, 102). In endothelial cells, temperature-sensitive Ca2+ entry through TRPV4 could have important consequences, e.g., for a steady-state production of nitric oxide, and might contribute to the known vasoconstriction and vasodilatation of peripheral blood vessels induced by cooling and warming, respectively (46). In addition, the temperature sensitivity of endothelial TRPV4 might suggest a role in mediating inflammatory pathophysiology in fever, e.g., by changing barrier properties that depend on Ca2+ influx (79).
Until now, TRPV4 is the only TRP channel that has been put forward as a potential constituent of a mammalian mechanotransducer (42), although its biophysical properties do not really match those of a mechanosensitive channel, because pressure applied to TRPV4-expressing cell-attached patches does not activate this channel (74). Nevertheless, it is an interesting possibility that TRPV4 is involved in mechanosensing, e.g., in endothelial cells via a mechanostimulation of PLA2 and subsequent activation by AA and 5',6'-EET (96). Interestingly, TRPV4 responds to shear stress, which might be especially important for endothelial cell function (21, 53). The proposed mechanosensitivity of TRPV4 has also made it a candidate gene for inherited dominant nonsyndromic hearing impairment (25, 27).
The TRPV4 activators AEA and 2-AG likely play an important role in the control of the vascular tone and potentially in shock conditions (44, 69, 70, 92, 93, 105). Interestingly, their effects could not be fully explained by an action on CB1 and CB2 receptors or on TRPV1 channels (24, 29, 35, 36, 92). Our data about the activation of TRPV4 by AEA and 2-AG might provide the missing link for the action of these compounds on endothelium.
Endocannabinoids are potent neuromodulators that may mainly act as retrograde messengers (20, 98). The finding that endocannabinoids are involved in TRPV4 activation identifies a new molecular target for cannabinoids and provides a link to modulation of synaptic function (16). In this respect, it might be of interest that the gene locus for the human TRPV4 channel is associated with bipolar affective disorder (14).
It has been shown that TRPV4 has a physiological role in rat primary afferent neurons and is involved in the detection of osmolarity in nociceptors (2). TRPV4 is thus a sensory transducer for osmotic stimulus-induced nociception. The TRPV4 protein is transported in sensory nerve distally toward the peripheral nerve endings. Single-fiber recordings on C-fibers showed an activation due to a hypotonic stimulus and, in addition, an enhanced production of the hyperalgesic inflammatory mediator prostaglandin E2. It was also shown that this osmotransduction causes nociception and induced pain-related behavior in mice. This is the first report on the role of TRPV4 in pain signaling. Thus we conclude that TRPV4 might be a new target for the development of novel analgesics.
The recently described TRPV4-deficient mouse shows a markedly reduced sensitivity of the tail to pressure and acidic nociception, which is compatible with a role of TRPV4 in mechanosensation. The threshold to noxious stimuli and the conduction velocity of myelinated nerves responding to stimuli were also impaired, indicating that TRPV4 might be essential for the normal detection of pressure by a high-threshold mechanosensor (76). Another functional role of TRPV4 suggested by the Suzuki group is its putative role in osmoregulation (47). TRPV4 is expressed in the cerebral circumventricular organs (42), which is important for regulation of water input and/or osmolarity in the body. In TRPV4-deficient mice, water intake behavior, or serum osmolarity, and serum vasopressin (AVP), were not changed. During short-term salt ingestion, however, serum AVP and AVP secretion were significantly increased. In brain slices, hyperosmolarity exaggerated AVP secretion. It was concluded that TRPV4 might transmit a negative signal for AVP. The underlying mechanism is unclear, because in this case hyperosmolarity might be able to activate TRPV4.
Some clues for the functional role of TRPV4 may be obtained from TRPV subfamily members in C. elegans and Drosophila. OSM-9, one of the five C. elegans TRPV channels, is present in chemosensory and mechanosensory neurons, and OSM-9-deficient worms have defective olfactory and mechanosensory responses (12). Together with other TRPV channels (e.g., OCR-2), OSM-9 is essential for the diverse sensory functions and localized in sensory cilia (80). Importantly, the different C. elegans TRPV channels promote the targeting of each other to cilia. Likely, different combinations of TRPV proteins allow cell type-specific regulation of channel function and localization, and combinations of TRPV proteins may direct different functions to distinct subcellular locations. The D. melanogaster genome includes two predicted TRPV genes (43, 80). One gene encodes an 833-amino acid protein called Nanchung (Nan), which shares several topological hallmarks with TRPV4. Functional expression of Nan results in a Ca2+-permeable channel activated by cell swelling. Nan is exclusively expressed in chordotonal neurons and is localized in the sensory cilia of the Drosophila antennas. Antennal sound-evoked potentials are completely absent in mutants lacking Nan. This TRPV channel therefore acts, at least in Drosophila, as a chordotonal mechanotransducer that is essential for hearing (41).
| ACKNOWLEDGMENTS |
|---|
GRANTS
This work was supported by the Belgian Federal Government, the Flemish Government, and the Onderzoeksraad KU Leuven (GOA 99/07, F.W.O. G.0213.99, F.W.O. G. 0136.00; F.W.O. G.0172.03, Interuniversity Poles of Attraction Program, IUAP, and CF-Pronet).
| FOOTNOTES |
|---|
After acceptance of this paper, the W. Liedtle laboratory published impressive data on the involvement of TRPV4 in osmoregulation. TRPV4-deficient mice drink less water, become more hyperosmolar, have a decreased blood level of antidiuretic hormone, and show an impaired response to hyper- and hyposmolar stimuli. Data indicate that TRPV4 is a necessary osmotic sensor in the circumventricular organs in the mammalian CNS (Liedtke W and Friedman JM. Abnormal osmotic regulation in trpv4/ mice. Proc Natl Acad Sci October 27, 2003; 10.1073/pnas.173541610).
| REFERENCES |
|---|
|
|
|---|
2. Alessandri-Haber N, Yeh JJ, Boyd AE, Parada CA, Chen X, Reichling DB, and Levine JD. Hypotonicity induces TRPV4-mediated nociception in rat. Neuron 39: 497511, 2003.[CrossRef][Web of Science][Medline]
3. Basavappa S, Pedersen SF, Jorgensen NK, Ellory JC, and Hoffmann EK. Swelling-induced arachidonic acid release via the 85-kDa cPLA2 in human neuroblastoma cells. J Neurophysiol 79: 14411449, 1998.
4. Benham CD, Davis JB, and Randall AD. Vanilloid and TRP channels: a family of lipid-gated cation channels. Neuropharmacology 42: 873888, 2002.[CrossRef][Web of Science][Medline]
5. Boulant JA. Role of the preoptic-anterior hypothalamus in thermoregulation and fever. Clin Infect Dis 31, Suppl 5: S157S161, 2000.[CrossRef][Web of Science][Medline]
6. Bourque CW and Oliet SH. Osmoreceptors in the central nervous system. Annu Rev Physiol 59: 601619, 1997.[CrossRef][Web of Science][Medline]
7. Caterina MJ, Leffler A, Malmberg AB, Martin WJ, Trafton J, Petersen-Zeitz KR, Koltzenburg M, Basbaum AI, and Julius D. Impaired nociception and pain sensation in mice lacking the capsaicin receptor. Science 288: 306313, 2000.
8. Caterina MJ, Rosen TA, Tominaga M, Brake AJ, and Julius D. A capsaicin-receptor homologue with a high threshold for noxious heat. Nature 398: 436441, 1999.[CrossRef][Medline]
9. Caterina MJ, Schumacher MA, Tominaga M, Rosen TA, Levine JD, and Julius D. The capsaicin receptor: a heat-activated ion channel in the pain pathway. Nature 389: 816824, 1997.[CrossRef][Web of Science][Medline]
10. Chung MK, Lee H, and Caterina MJ. Warm temperatures activate TRPV4 in mouse 308 keratinocytes. J Biol Chem 278: 3203732046, 2003.
11. Clapham DE, Runnels LW, and Strubing C. The trp ion channel family. Nat Rev Neurosci 2: 387396, 2001.[Web of Science][Medline]
12. Colbert HA, Smith TL, and Bargmann CI. OSM-9, a novel protein with structural similarity to channels, is required for olfaction, mechanosensation, and olfactory adaptation in Caenorhabditis elegans. J Neurosci 17: 82598269, 1997.
13. Cravatt BF, Giang DK, Mayfield SP, Boger DL, Lerner RA, and Gilula NB. Molecular characterization of an enzyme that degrades neuromodulatory fatty-acid amides. Nature 384: 8387, 1996.[CrossRef][Medline]
14. Delany NS, Hurle M, Facer P, Alnadaf T, Plumpton C, Kinghorn I, See CG, Costigan M, Anand P, Woolf CJ, Crowther D, Sanseau P, and Tate SN. Identification and characterization of a novel human vanilloid receptor-like protein, VRL-2. Physiol Genomics 4: 165174, 2001.
15. Di Marzo V, Fontana A, Cadas H, Schinelli S, Cimino G, Schwartz JC, and Piomelli D. Formation and inactivation of endogenous cannabinoid anandamide in central neurons. Nature 372: 686691, 1994.[CrossRef][Medline]
16. Di Marzo V, Melck D, Bisogno T, and De Petrocellis L. Endocannabinoids: endogenous cannabinoid receptor ligands with neuromodulatory action. Trends Neurosci 21: 521528, 1998.[CrossRef][Web of Science][Medline]
17. Doyle DA, Morais Cabral J, Pfuetzner RA, Kuo A, Gulbis JM, Cohen SL, Chait BT, and MacKinnon R. The structure of the potassium channel: molecular basis of K+ conduction and selectivity. Science 280: 6977, 1998.
18. Fernandez-Fernandez JM, Nobles M, Currid A, Vazquez E, and Valverde MA. Maxi K+ channel mediates regulatory volume decrease response in a human bronchial epithelial cell line. Am J Physiol Cell Physiol 283: C1705C1714, 2002.
19. Fleming I. Cytochrome P450 enzymes in vascular homeostasis. Circ Res 89: 753762, 2001.
20. Freund TF, Katona I, and Piomelli D. Role of endogenous cannabinoids in synaptic signaling. Physiol Rev 83: 10171066, 2003.
21. Gao X, Wu L, and O'Neil RG. Temperature-modulated diversity of TRPV4 channel gating: activation by physical stresses and phorbol ester derivatives through protein kinase C-dependent and -independent pathways. J Biol Chem 278: 2712922737, 2003.
22. Garcia-Anoveros J and Corey DP. The molecules of mechanosensation. Annu Rev Neurosci 20: 567594, 1997.[CrossRef][Web of Science][Medline]
23. Garcia-Martinez C, Morenilla-Palao C, Planells-Cases R, Merino JM, and Ferrer-Montiel A. Identification of an aspartic residue in the P-loop of the vanilloid receptor that modulates pore properties. J Biol Chem 275: 3255232558, 2000.
24. Grainger J and Boachie Ansah G. Anandamide-induced relaxation of sheep coronary arteries: the role of the vascular endothelium, arachidonic acid metabolites and potassium channels. Br J Pharmacol 134: 10031012, 2001.[CrossRef][Web of Science][Medline]
25. Greene CC, McMillan PM, Barker SE, Kurnool P, Lomax MI, Burmeister M, and Lesperance MM. DFNA25, a novel locus for dominant nonsyndromic hereditary hearing impairment, maps to 12q21 24 Am J Hum Genet 68: 254260, 2001.[CrossRef][Web of Science][Medline]
26. Güler A, Lee H, Shimizu I, and Caterina MJ. Heat-evoked activation of TRPV4 (VR-OAC). J Neurosci 22: 64086414, 2002.
27. Gunthorpe MJ, Benham CD, Randall A, and Davis JB. The diversity in the vanilloid (TRPV) receptor family of ion channels. Trends Pharmacol Sci 23: 183191, 2002.[CrossRef][Medline]
28. Hara Y, Wakamori M, Ishii M, Maeno E, Nishida M, Yoshida T, Yamada H, Shimizu S, Mori E, Kudoh J, Shimizu N, Kurose H, Okada Y, Imoto K, and Mori Y. LTRPC2 Ca2+-permeable channel activated by changes in redox status confers susceptibility to cell death. Mol Cell 9: 163173, 2002.[CrossRef][Web of Science][Medline]
29. Harris D, McCulloch AI, Kendall DA, and Randall MD. Characterization of vasorelaxant response to anandamide in the rat mesenteric arterial bed. J Physiol 539: 893902, 2002.
30. Hayes P, Meadows HJ, Gunthorpe MJ, Harries MH, Duckworth DM, Cairns W, Harrison DC, Clarke CE, Ellington K, Prinjha RK, Barton AJ, Medhurst AD, Smith GD, Topp S, Murdock P, Sanger GJ, Terrett J, Jenkins O, Benham CD, Randall AD, Gloger IS, and Davis JB. Cloning and functional expression of a human orthologue of rat vanilloid receptor-1. Pain 88: 205215, 2000.[CrossRef][Web of Science][Medline]
31. Hoenderop JG, van der Kemp AW, Hartog A, van de Graaf SF, van Os CH, Willems PH, and Bindels RJ. Molecular identification of the apical Ca2+ channel in 1, 25-dihydroxyvitamin D3-responsive epithelia. J Biol Chem 274: 83758378, 1999.
32. Hoenderop JGJ, Voets T, Hoefs S, Weidema F, Prenen J, Nilius B, and Bindels RJM. Homo- and heterotetrameric architecture of the epithelial Ca2+ channels TRPV5 and TRPV6. EMBO J 22: 776785, 2003.[CrossRef][Web of Science][Medline]
33. Hori A, Minato K, and Kobayashi S. Warming-activated channels of warm-sensitive neurons in rat hypothalamic slices. Neurosci Lett 275: 9396, 1999.[CrossRef][Web of Science][Medline]
34. Hwang SW, Cho H, Kwak J, Lee SY, Kang CJ, Jung J, Cho S, Min KH, Suh YG, Kim D, and Oh U. Direct activation of capsaicin receptors by products of lipoxygenases: endogenous capsaicin-like substances. Proc Natl Acad Sci USA 97: 61556160, 2000.
35. Jarai Z, Wagner JA, Goparaju SK, Wang L, Razdan RK, Sugiura T, Zimmer AM, Bonner TI, Zimmer A, and Kunos G. Cardiovascular effects of 2-arachidonoyl glycerol in anesthetized mice. Hypertension 35: 679684, 2000.
36. Jarai Z, Wagner JA, Varga K, Lake KD, Compton DR, Martin BR, Zimmer AM, Bonner TI, Buckley NE, Mezey E, Razdan RK, Zimmer A, and Kunos G. Cannabinoid-induced mesenteric vasodilation through an endothelial site distinct from CB1 or CB2 receptors. Proc Natl Acad Sci USA 96: 1413614141, 1999.
37. Jia Y, McLeod RL, Wang X, Parra LE, Egan RW, and Hey JA. Anandamide induces cough in conscious guinea-pigs through VR1 receptors. Br J Pharmacol 137: 831836, 2002.[CrossRef][Web of Science][Medline]
38. Jordt SE and Julius D. Molecular basis for species-specific sensitivity to "hot" chili peppers. Cell 108: 421430, 2002.[CrossRef][Web of Science][Medline]
39. Jung J, Lee SY, Hwang SW, Cho H, Shin J, Kang YS, Kim S, and Oh U. Agonist recognition sites in the cytosolic tails of vanilloid receptor 1. J Biol Chem 277: 4444844454, 2002.
40. Kazanietz MG. Novel "nonkinase" phorbol ester receptors: the C1 domain connection. Mol Pharmacol 61: 759767, 2002.
41. Kim J, Chung DY, Park D, Choix S, Shin DW, Soh H, Lee HW, Son W, Yim J, Park CS, Kernan MJ, and Kim C. A TRPV family ion channel required for hearing in Drosophila. Nature 424: 8184, 2003.[CrossRef][Medline]
42. Liedtke W, Choe Y, Marti-Renom MA, Bell AM, Denis CS, Sali A, Hudspeth AJ, Friedman JM, and Heller S. Vanilloid receptor-related osmotically activated channel (VR-OAC), a candidate vertebrate osmoreceptor. Cell 103: 525535, 2000.[CrossRef][Web of Science][Medline]
43. Littleton JT and Ganetzky B. Ion channels and synaptic organization: analysis of the Drosophila genome. Neuron 26: 3543, 2000.[CrossRef][Web of Science][Medline]
44. Maccarrone M, Bari M, Lorenzon T, Bisogno T, Di Marzo V, and Finazzi-Argo A. Anandamide uptake by human endothelial cells and its regulation by nitric oxide. J Biol Chem 275: 1348413492, 2000.
45. Mechoulam R, Fride E, and DiMarzo V. Endocannabinoids. Eur J Pharmacol 359: 118, 1998.[CrossRef][Web of Science][Medline]
46. Minson CT, Berry LT, and Joyner MJ. Nitric oxide and neurally mediated regulation of skin blood flow during local heating. J Appl Physiol 91: 16191626, 2001.
47. Mizuno A, Matsumoto N, Imai M, and Suzuki M. Impaired osmotic sensation in mice lacking TRPV4. Am J Physiol Cell Physiol 285: C96C101, 2003.
48. Montell C. Physiology, phylogeny, and functions of the TRP superfamily of cation channels. Science's STKE July 10, 2001; 10.1126/stke.2001.90.re1.
49. Montell C, Birnbaumer L, and Flockerzi V. The TRP channels, a remarkable functional family. Cell 108: 595598, 2002.[CrossRef][Web of Science][Medline]
50. Montell C, Birnbaumer L, Flockerzi V, Bindels RJ, Bruford EA, Caterina MJ, Clapham D, Harteneck C, Heller S, Julius D, Kojima I, Mori Y, Penner R, Prawitt D, Scharenberg AM, Schultz G, Shimizu S, and Zhu MX. A unified nomenclature for the superfamily of TRP cation channels. Mol Cell 9: 229231, 2002.[CrossRef][Web of Science][Medline]
51. Mutai H and Heller S. Vertebrate and invertebrate TRPV-like mechanoreceptor. Cell Calcium 33: 471478, 2003.[CrossRef][Web of Science][Medline]
52. Niemeyer BA, Bergs C, Wissenbach U, Flockerzi V, and Trost C. Competitive regulation of CaT-like-mediated Ca2+ entry by protein kinase C and calmodulin. Proc Natl Acad Sci USA 98: 36003605, 2001.
53. Nilius B, Droogmans G, and Wondergem R. TRP channels in endothelium: solving the calcium entry puzzle? Endothelium 10: 515, 2003.[CrossRef][Web of Science][Medline]
54. Nilius B, Prenen J, Hoenderop JG, Vennekens R, Hoefs S, Weidema AF, Droogmans G, and Bindels RJ. Fast and slow inactivation kinetics of the Ca2+ channels ECaC1 and ECaC2 (TRPV5 and TRPV6). Role of the intracellular loop located between transmembrane segments 2 and 3. J Biol Chem 277: 3085230858, 2002.
55. Nilius B, Prenen J, Wissenbach U, Bodding M, and Droogmans G. Differential activation of the volume-sensitive cation channel TRP12 (OTRPC4) and volume-regulated anion currents in HEK-293 cells. Pflügers Arch 443: 227233, 2001.[CrossRef][Web of Science][Medline]
56. Nilius B, Vennekens R, Prenen J, Hoenderop JG, Droogmans G, and Bindels RJ. The single pore residue Asp542 determines Ca2+ permeation and Mg2+ block of the epithelial Ca2+ channel. J Biol Chem 276: 10201025, 2001.
57. Olah Z, Karai L, and Iadarola MJ. Protein kinase C
is required for vanilloid receptor 1 activation. Evidence for multiple signaling pathways. J Biol Chem 277: 3575235759, 2002.
58. Patel AJ, Honore E, Maingret F, Lesage F, Fink M, Duprat F, and Lazdunski M. A mammalian two pore domain mechano-gated S-like K+ channel. EMBO J 17: 42834290, 1998.[CrossRef][Web of Science][Medline]
59. Pedersen S, Lambert IH, Thoroed SM, and Hoffmann EK. Hypotonic cell swelling induces translocation of the
isoform of cytosolic phospholipase A2 but not the
isoform in Ehrlich ascites tumor cells. Eur J Biochem 267: 55315539, 2000.[Web of Science][Medline]
60. Peier AM, Reeve AJ, Andersson DA, Moqrich A, Earley TJ, Hergarden AC, Story GM, Colley S, Hogenesch JB, McIntyre P, Bevan S, and Patapoutian A. A heat-sensitive TRP channel expressed in keratinocytes. Science 296: 20462049, 2002.
61. Peng JB, Brown EM, and Hediger MA. Structural conservation of the genes encoding CaT1, CaT2, and related cation channels. Genomics 76: 99109, 2001.[CrossRef][Web of Science][Medline]
62. Peng JB, Chen XZ, Berger UV, Vassilev PM, Brown EM, and Hediger MA. A rat kidney-specific calcium transporter in the distal nephron. J Biol Chem 275: 2818628194, 2000.
63. Peng JB, Chen XZ, Berger UV, Vassilev PM, Tsukaguchi H, Brown EM, and Hediger MA. Molecular cloning and characterization of a channel-like transporter mediating intestinal calcium absorption. J Biol Chem 274: 2273922746, 1999.
64. Peng JB, Chen XZ, Berger UV, Weremowicz S, Morton CC, Vassilev PM, Brown EM, and Hediger MA. Human calcium transport protein CaT1. Biochem Biophys Res Commun 278: 326332, 2000.[CrossRef][Web of Science][Medline]
65. Peng JB and Hediger MA. A family of calcium-permeable channels in the kidney: distinct roles in renal calcium handling. Curr Opin Nephrol Hypertens 11: 555561, 2002.[CrossRef][Web of Science][Medline]
66. Piomelli D. The ligand that came from within. Trends Pharmacol Sci 22: 1719, 2001.[CrossRef][Medline]
67. Premkumar LS and Ahern GP. Induction of vanilloid receptor channel activity by protein kinase C. Nature 408: 985990, 2000.[CrossRef][Medline]
68. Prescott ED and Julius D. A modular PIP2 binding site as a determinant of capsaicin receptor sensitivity. Science 300: 12841288, 2003.
69. Randall MD and Kendall DA. Anandamide and endothelium-derived hyperpolarizing factor act via a common vasorelaxant mechanism in rat mesentery. Eur J Pharmacol 346: 5153, 1998.[CrossRef][Web of Science][Medline]
70. Randall MD and Kendall DA. Endocannabinoids: a new class of vasoactive substances. Trends Pharmacol Sci 19: 5558, 1998.[CrossRef][Medline]
71. Roman RJ. P-450 metabolites of arachidonic acid in the control of cardiovascular function. Physiol Rev 82: 131185, 2002.
72. Smart D, Gunthorpe MJ, Jerman JC, Nasir S, Gray J, Muir AI, Chambers JK, Randall AD, and Davis JB. The endogenous lipid anandamide is a full agonist at the human vanilloid receptor (hVR1). Br J Pharmacol 129: 227230, 2000.[CrossRef][Web of Science][Medline]
73. Smith GD, Gunthorpe J, Kelsell RE, Hayes PD, Reilly P, Facer P, Wright JE, Jerman JC, Walhin JP, Ooi L, Egerton J, Charles KJ, Smart D, Randall AD, Anand P, and Davis JB. TRPV3 is a temperature-sensitive vanilloid receptor-like protein. Nature 418: 186190, 2002.[CrossRef][Medline]
74. Strotmann R, Harteneck C, Nunnenmacher K, Schultz G, and Plant TD. OTRPC4, a nonselective cation channel that confers sensitivity to extracellular osmolarity. Nat Cell Biol 2: 695702, 2000.[CrossRef][Web of Science][Medline]
75. Strotmann R, Schultz G, and Plant TD. Ca2+-dependent potentiation of the nonselective cation channel TRPV4 is mediated by a carboxy terminal calmodulin binding site. J Biol Chem 278: 2654126549, 2003.
76. Suzuki M, Mizuno A, Kodaira K, and Imai M. Impaired pressure sensation with mice lacking TRPV4. J Biol Chem 270: 2266422668, 2003.
77. Szallasi A and Blumberg PM. Vanilloid (capsaicin) receptors and mechanisms. Pharmacol Rev 51: 159212, 1999.
78. Szallasi A, Szabo T, Biro T, Modarres S, Blumberg PM, Krause JE, Cortright DN, and Appendino G. Resiniferatoxin-type phorboid vanilloids display capsaicin-like selectivity at native vanilloid receptors on rat DRG neurons and at the cloned vanilloid receptor VR1. Br J Pharmacol 128: 428434, 1999.[CrossRef][Web of Science][Medline]
79. Tiruppathi C, Freichel M, Vogel SM, Paria BC, Mehta D, Flockerzi V, and Malik AB. Impairment of store-operated Ca2+ entry in TRPC4/ mice interferes with increase in lung microvascular permeability. Circ Res 91: 7076, 2002.
80. Tobin DM, Madsen DM, Kahn Kirby A, Peckol EL, Moulder G, Barstead R, Maricq AV, and Bargmann CI. Combinatorial expression of TRPV channel proteins defines their sensory functions and subcellular localization in C. elegans neurons. Neuron 35: 307318, 2002.[CrossRef][Web of Science][Medline]
81. Tominaga M, Caterina MJ, Malmberg AB, Rosen TA, Gilbert H, Skinner K, Raumann BE, Basbaum AI, and Julius D. The cloned capsaicin receptor integrates multiple pain-producing stimuli. Neuron 21: 531543, 1998.[CrossRef][Web of Science][Medline]
82. Toth A, Kedei N, Wang Y, and Blumberg PM. Arachidonyl dopamine as a ligand for the vanilloid receptor VR1 of the rat. Life Sci 73: 487498, 2003.[CrossRef][Web of Science][Medline]
83. Travis KA, Bockholt HJ, Zardetto Smith AM, and Johnson AK. In vitro thermosensitivity of the midline thalamus. Brain Res 686: 1722, 1995.[CrossRef][Web of Science][Medline]
84. Ueda N. Endocannabinoid hydrolases. Prostaglandins Other Lipid Mediat 6869: 521534, 2002.
85. Vellani V, Mapplebeck S, Moriondo A, Davis JB, and McNaughton PA. Protein kinase C activation potentiates gating of the vanilloid receptor VR1 by capsaicin, protons, heat and anandamide. J Physiol 534: 813825, 2001.
86. Vennekens R, Hoenderop JG, Prenen J, Stuiver M, Willems PH, Droogmans G, Nilius B, and Bindels RJ. Permeation and gating properties of the novel epithelial Ca2+ channel. J Biol Chem 275: 39633969, 2000.
87. Vennekens R, Prenen J, Hoenderop JG, Bindels RJ, Droogmans G, and Nilius B. Modulation of the epithelial Ca2+ channel ECaC by extracellular pH. Pflügers Arch 442: 237242, 2001.[CrossRef][Web of Science][Medline]
88. Vennekens R, Prenen J, Hoenderop JG, Bindels RJ, Droogmans G, and Nilius B. Pore properties and ionic block of the rabbit epithelial calcium channel expressed in HEK 293 cells. J Physiol 530: 183191, 2001.
89. Voets T, Janssens A, Prenen J, Droogmans D, and Nilius G. Mg2+-dependent gating and strong inward rectification of the cation channel TRPV6. J Gen Physiol 121: 245260, 2003.
90. Voets T, Prenen J, Fleig A, Vennekens R, Watanabe H, Hoenderop JGJ, Bindels RJM, Droogmans G, Penner R, and Nilius B. CaT1 and the calcium release-activated calcium channel manifest distinct pore properties. J Biol Chem 276: 4776747770, 2001.
91. Voets T, Prenen J, Vriens J, Watanabe H, Janssens A, Wissenbach U, Bödding M, Droogmans G, and Nilius B. Molecular determinants of permeation through the cation channel TRPV4. J Biol Chem 277: 3370433710, 2002.
91. Vriens J, Watanabe H, Janssens A, Droogmans G, Voets T, and Nilius B. Cell swelling, heat and chemical agonists use distinct pathways for the activation of the cation channel TRPV4. Proc Natl Acad Sci USA. In press.
92. Wagner JA, Varga K, Jarai Z, and Kunos G. Mesenteric vasodilation mediated by endothelial anandamide receptors. Hypertension 33, Suppl S: 429434, 1999.
93. Wagner JA, Varga K, and Kunos G. Cardiovascular actions of cannabinoids and their generation during shock. J Mol Med 76: 824836, 1998.[CrossRef][Web of Science][Medline]
94. Watanabe H, Davis JB, Smart D, Jerman JC, Smith GD, Hayes P, Vriens J, Cairns W, Wissenbach U, Prenen J, Flockerzi V, Droogmans G, Benham CD, and Nilius B. Activation of TRPV4 channels (hVRL-2/mTRP12) by phorbol derivatives. J Biol Chem 277: 1356913577, 2002.
95. Watanabe H, Vriens J, Janssens A, Wondergem R, Droogmans G, and Nilius B. Modulation of TRPV4 gating by intra- and extracellular Ca2+. Cell Calcium 33: 489495, 2003.[CrossRef][Web of Science][Medline]
96. Watanabe H, Vriens J, Prenen J, Droogmans G, Voets T, and Nilius B. Anandamide and arachidonic acid use epoxyeicosatrienoic acids to activate TRPV4 channels. Nature 424: 434438, 2003.[CrossRef][Medline]
97. Watanabe H, Vriens J, Suh SH, Benham CD, Droogmans G, and Nilius B. Heat-evoked activation of TRPV4 channels in an HEK293 cell expression system and in native mouse aorta endothelial cells. J Biol Chem 277: 4704447051, 2002.
98. Wilson RI and Nicoll RA. Endocannabinoid signaling in the brain. Science 296: 678682, 2002.
99. Wissenbach U, Bodding M, Freichel M, and Flockerzi V. Trp12, a novel Trp related protein from kidney. FEBS Lett 485: 127134, 2000.[CrossRef][Web of Science][Medline]
100. Xu H, Zhao H, Tian W, Yoshida K, Roullet JB, and Cohen DM. Regulation of a TRP channel by tyrosine phosphorylation: Src family kinase-dependent phosphorylation of TRPV4 on Y253 mediates its response to hypotonic stress. J Biol Chem 278: 1152011527, 2003.
101. Xu HX, Ramsey IS, Kotecha SA, Moran MM, Chong JA, Lawson D, Ge P, Lilly J, Silos-Santiago I, Xie Y, DiStefano PS, Curtis R, and Clapham DE. TRPV3 is a calcium-permeable temperature-sensitive cation channel. Nature 418: 181186, 2002.[CrossRef][Medline]
102. Yuspa SH, Kilkenny AE, Steinert PM, and Roop DR. Expression of murine epidermal differentiation markers is tightly regulated by restricted extracellular calcium concentrations in vitro. J Cell Biol 109: 12071217, 1989.
103. Zhou Y, Morais-Cabral JH, Kaufman A, and MacKinnon R. Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0 Å resolution. Nature 414: 4348, 2001.[CrossRef][Medline]
104. Zygmunt PM, Julius I, Di Marzo I, and Hogestatt ED. Anandamide the other side of the coin. Trends Pharmacol Sci 21: 4344, 2000.[CrossRef][Medline]
105. Zygmunt PM, Petersson J, Andersson DA, Chuang H, Sorgard M, Di Marzo V, Julius D, and Hogestatt ED. Vanilloid receptors on sensory nerves mediate the vasodilator action of anandamide. Nature 400: 452457, 1999.[CrossRef][Medline]
This article has been cited by other articles:
![]() |
G. Zhu, ICGN Investigators, A. Gulsvik, P. Bakke, S. Ghatta, W. Anderson, D. A. Lomas, E. K. Silverman, and S. G. Pillai Association of TRPV4 gene polymorphisms with chronic obstructive pulmonary disease Hum. Mol. Genet., June 1, 2009; 18(11): 2053 - 2062. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Vriens, G. Appendino, and B. Nilius Pharmacology of Vanilloid Transient Receptor Potential Cation Channels Mol. Pharmacol., June 1, 2009; 75(6): 1262 - 1279. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. K. Hoffmann, I. H. Lambert, and S. F. Pedersen Physiology of Cell Volume Regulation in Vertebrates Physiol Rev, January 1, 2009; 89(1): 193 - 277. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. E. Loot, R. Popp, B. Fisslthaler, J. Vriens, B. Nilius, and I. Fleming Role of cytochrome P450-dependent transient receptor potential V4 activation in flow-induced vasodilatation Cardiovasc Res, December 1, 2008; 80(3): 445 - 452. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. Lu, S. Boros, Q. Chang, R. J. Bindels, and J. G. Hoenderop The {beta}-glucuronidase klotho exclusively activates the epithelial Ca2+ channels TRPV5 and TRPV6 Nephrol. Dial. Transplant., November 1, 2008; 23(11): 3397 - 3402. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Karasawa, Q. Wang, Y. Fu, D. M. Cohen, and P. S. Steyger TRPV4 enhances the cellular uptake of aminoglycoside antibiotics J. Cell Sci., September 1, 2008; 121(17): 2871 - 2879. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Kottgen, B. Buchholz, M. A. Garcia-Gonzalez, F. Kotsis, X. Fu, M. Doerken, C. Boehlke, D. Steffl, R. Tauber, T. Wegierski, et al. TRPP2 and TRPV4 form a polymodal sensory channel complex J. Cell Biol., August 11, 2008; 182(3): 437 - 447. [Abstract] [Full Text] [PDF] |
||||
![]() |
M.-Y. Jian, J. A. King, A.-B. Al-Mehdi, W. Liedtke, and M. I. Townsley High Vascular Pressure-Induced Lung Injury Requires P450 Epoxygenase-Dependent Activation of TRPV4 Am. J. Respir. Cell Mol. Biol., April 1, 2008; 38(4): 386 - 392. [Abstract] [Full Text] [PDF] |
||||
![]() |
V. Meseguer, Y. Karashima, K. Talavera, D. D'Hoedt, T. Donovan-Rodriguez, F. Viana, B. Nilius, and T. Voets Transient Receptor Potential Channels in Sensory Neurons Are Targets of the Antimycotic Agent Clotrimazole J. Neurosci., January 16, 2008; 28(3): 576 - 586. [Abstract] [Full Text] [PDF] |
||||
![]() |
L. Wu, X. Gao, R. C. Brown, S. Heller, and R. G. O'Neil Dual role of the TRPV4 channel as a sensor of flow and osmolality in renal epithelial cells Am J Physiol Renal Physiol, November 1, 2007; 293(5): F1699 - F1713. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Hamanaka, M.-Y. Jian, D. S. Weber, D. F. Alvarez, M. I. Townsley, A. B. Al-Mehdi, J. A. King, W. Liedtke, and J. C. Parker TRPV4 initiates the acute calcium-dependent permeability increase during ventilator-induced lung injury in isolated mouse lungs Am J Physiol Lung Cell Mol Physiol, October 1, 2007; 293(4): L923 - L932. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Fredsted, H. Gissel, K. Madsen, and T. Clausen Causes of excitation-induced muscle cell damage in isometric contractions: mechanical stress or calcium overload? Am J Physiol Regulatory Integrative Comp Physiol, June 1, 2007; 292(6): R2249 - R2258. [Abstract] [Full Text] [PDF] |
||||
![]() |
B. Nilius, G. Owsianik, T. Voets, and J. A. Peters Transient Receptor Potential Cation Channels in Disease Physiol Rev, January 1, 2007; 87(1): 165 - 217. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. C. Hardie TRP channels and lipids: from Drosophila to mammalian physiology J. Physiol., January 1, 2007; 578(1): 9 - 24. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Saito and R. Shingai Evolution of thermoTRP ion channel homologs in vertebrates Physiol Genomics, November 21, 2006; 27(3): 219 - 230. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. E. Hills, R. Bland, D. C. Wheelans, J. Bennett, P. M. Ronco, and P. E. Squires Glucose-evoked alterations in connexin43-mediated cell-to-cell communication in human collecting duct: a possible role in diabetic nephropathy Am J Physiol Renal Physiol, November 1, 2006; 291(5): F1045 - F1051. [Abstract] [Full Text] [PDF] |
||||
![]() |
F.-R. E. Curry and C. A. Glass TRP Channels and the Regulation of Vascular Permeability: New Insights From the Lung Microvasculature Circ. Res., October 27, 2006; 99(9): 915 - 917. [Full Text] [PDF] |
||||
![]() |
D. F. Alvarez, J. A. King, D. Weber, E. Addison, W. Liedtke, and M. I. Townsley Transient Receptor Potential Vanilloid 4-Mediated Disruption of the Alveolar Septal Barrier: A Novel Mechanism of Acute Lung Injury Circ. Res., October 27, 2006; 99(9): 988 - 995. [Abstract] [Full Text] [PDF] |
||||
![]() |
G. Gamba TRPV4: a new target for the hypertension-related kinases WNK1 and WNK4 Am J Physiol Renal Physiol, June 1, 2006; 290(6): F1303 - F1304. [Full Text] [PDF] |
||||
![]() |
N. Alessandri-Haber, O. A. Dina, E. K. Joseph, D. Reichling, and J. D. Levine A transient receptor potential vanilloid 4-dependent mechanism of hyperalgesia is engaged by concerted action of inflammatory mediators. J. Neurosci., April 5, 2006; 26(14): 3864 - 3874. [Abstract] [Full Text] [PDF] |
||||
![]() |
V. K. Sidhaye, A. D. Guler, K. S. Schweitzer, F. D'Alessio, M. J. Caterina, and L. S. King Transient receptor potential vanilloid 4 regulates aquaporin-5 abundance under hypotonic conditions PNAS, March 21, 2006; 103(12): 4747 - 4752. [Abstract] [Full Text] [PDF] |
||||
![]() |
X. Liu, P. Zhu, and B. D. Freedman Multiple eicosanoid-activated nonselective cation channels regulate B-lymphocyte adhesion to integrin ligands Am J Physiol Cell Physiol, March 1, 2006; 290(3): C873 - C882. [Abstract] [Full Text] [PDF] |
||||
![]() |
V. Lyall, H. Pasley, T.-H. T. Phan, S. Mummalaneni, G. L. Heck, A. K. Vinnikova, and J. A. DeSimone Intracellular pH Modulates Taste Receptor Cell Volume and the Phasic Part of the Chorda Tympani Response to Acids J. Gen. Physiol., December 27, 2005; 127(1): 15 - 34. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. Guatteo, K. K. H. Chung, T. K. Bowala, G. Bernardi, N. B. Mercuri, and J. Lipski Temperature Sensitivity of Dopaminergic Neurons of the Substantia Nigra Pars Compacta: Involvement of Transient Receptor Potential Channels J Neurophysiol, November 1, 2005; 94(5): 3069 - 3080. [Abstract] [Full Text] [PDF] |
||||
![]() |
X. Yao and C. J. Garland Recent Developments in Vascular Endothelial Cell Transient Receptor Potential Channels Circ. Res., October 28, 2005; 97(9): 853 - 863. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Vriens, G. Owsianik, B. Fisslthaler, M. Suzuki, A. Janssens, T. Voets, C. Morisseau, B.D. Hammock, I. Fleming, R. Busse, et al. Modulation of the Ca2 Permeable Cation Channel TRPV4 by Cytochrome P450 Epoxygenases in Vascular Endothelium Circ. Res., October 28, 2005; 97(9): 908 - 915. [Abstract] [Full Text] [PDF] |
||||
![]() |
B. Nilius, T. Voets, and J. Peters TRP Channels in Disease Sci. Signal., August 2, 2005; 2005(295): re8 - re8. [Abstract] [Full Text] [PDF] |
||||
![]() |
Q. Gu, R.-L. Lin, H.-Z. Hu, M. X. Zhu, and L.-Y. Lee 2-Aminoethoxydiphenyl borate stimulates pulmonary C neurons via the activation of TRPV channels Am J Physiol Lung Cell Mol Physiol, May 1, 2005; 288(5): L932 - L941. [Abstract] [Full Text] [PDF] |
||||
![]() |
G. Appendino, L. De Petrocellis, M. Trevisani, A. Minassi, N. Daddario, A. S. Moriello, D. Gazzieri, A. Ligresti, B. Campi, G. Fontana, et al. Development of the First Ultra-Potent "Capsaicinoid" Agonist at Transient Receptor Potential Vanilloid Type 1 (TRPV1) Channels and Its Therapeutic Potential J. Pharmacol. Exp. Ther., February 1, 2005; 312(2): 561 - 570. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. G. J. Hoenderop, B. Nilius, and R. J. M. Bindels Calcium Absorption Across Epithelia Physiol Rev, January 1, 2005; 85(1): 373 - 422. [Abstract] [Full Text] [PDF] |
||||
![]() |
Q.-H. Liu, X. Liu, Z. Wen, B. Hondowicz, L. King, J. Monroe, and B. D. Freedman Distinct Calcium Channels Regulate Responses of Primary B Lymphocytes to B Cell Receptor Engagement and Mechanical Stimuli J. Immunol., January 1, 2005; 174(1): 68 - 79. [Abstract] [Full Text] [PDF] |
||||
![]() |
Z. Gong, W. Son, Y. Doo Chung, J. Kim, D. W. Shin, C. A. McClung, Y. Lee, H. W. Lee, D.-J. Chang, B.-K. Kaang, et al. Two Interdependent TRPV Channel Subunits, Inactive and Nanchung, Mediate Hearing in Drosophila J. Neurosci., October 13, 2004; 24(41): 9059 - 9066. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y. Jia, X. Wang, L. Varty, C. A. Rizzo, R. Yang, C. C. Correll, P. T. Phelps, R. W. Egan, and J. A. Hey Functional TRPV4 channels are expressed in human airway smooth muscle cells Am J Physiol Lung Cell Mol Physiol, August 1, 2004; 287(2): L272 - L278. [Abstract] [Full Text] [PDF] |
||||
![]() |
M.-K. Chung, H. Lee, A. Mizuno, M. Suzuki, and M. J. Caterina 2-Aminoethoxydiphenyl Borate Activates and Sensitizes the Heat-Gated Ion Channel TRPV3 J. Neurosci., June 2, 2004; 24(22): 5177 - 5182. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. Alessandri-Haber, O. A. Dina, J. J. Yeh, C. A. Parada, D. B. Reichling, and J. D. Levine Transient Receptor Potential Vanilloid 4 Is Essential in Chemotherapy-Induced Neuropathic Pain in the Rat J. Neurosci., May 5, 2004; 24(18): 4444 - 4452. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| Visit Other APS Journals Online |