Am J Physiol Cell Physiol Watch the video to see how APS reaches out to developing nations.
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


Am J Physiol Cell Physiol 286: C195-C205, 2004; doi:10.1152/ajpcell.00365.2003
0363-6143/04 $5.00
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Web of Science (95)
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Nilius, B.
Right arrow Articles by Voets, T.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Nilius, B.
Right arrow Articles by Voets, T.

INVITED REVIEW

TRPV4 calcium entry channel: a paradigm for gating diversity

Bernd Nilius, Joris Vriens, Jean Prenen, Guy Droogmans, and Thomas Voets

Department of Physiology, Campus Gasthuisberg, Katholieke Universiteit Leuven, 3000 Leuven, Belgium


    ABSTRACT
 TOP
 ABSTRACT
 THE TRPV SUBFAMILY
 TRPV4: STRUCTURE AND EXPRESSION
 TRPV4: FUNCTIONAL HALLMARKS
 THE TRPV4 PORE
 ACTIVATION MECHANISMS
 POSSIBLE PHYSIOLOGICAL FUNCTIONS...
 REFERENCES
 
The vanilloid receptor-1 (VR1, now TRPV1) was the founding member of a subgroup of cation channels within the TRP family. The TRPV subgroup contains six mammalian members, which all function as Ca2+ entry channels gated by a variety of physical and chemical stimuli. TRPV4, which displays 45% sequence identity with TRPV1, is characterized by a surprising gating promiscuity: it is activated by hypotonic cell swelling, heat, synthetic 4{alpha}-phorbols, and several endogenous substances including arachidonic acid (AA), the endocannabinoids anandamide and 2-AG, and cytochrome P-450 metabolites of AA, such as epoxyeicosatrienoic acids. This review summarizes data on TRPV4 as a paradigm of gating diversity in this subfamily of Ca2+ entry channels.

transient receptor potential; calcium channels; vanilloid receptor


THE FREE INTRACELLULAR CA22+ CONCENTRATION ([Ca +]i) is an important regulator of various cell functions. The most important mechanisms for increasing [Ca2+]i are release of Ca2+ from intracellular stores and entry of extracellular Ca2+ via diverse Ca2+ entry channels. In the last 10 years, several novel Ca2+ entry channels belonging to the still expanding family of TRP cation channels have been discovered. More than 20 mammalian TRP genes have been identified, encoding membrane proteins with six transmembrane segments (TM1–TM6) and a putative pore region formed by a short hydrophobic stretch between TM5 and TM6 (for detailed reviews, see Refs. 11, 48, 49). On the basis of their homology, mammalian TRP proteins are classified into three subfamilies (50): TRPC (canonical), TRPV (vanilloid), and TRPM (melastatin). The core transmembrane channel structure of TRP channels resembles that of the pore-forming subunits of voltage-gated and cyclic nucleotide-gated channels and consists of a coassembly of four subunits (32).


    THE TRPV SUBFAMILY
 TOP
 ABSTRACT
 THE TRPV SUBFAMILY
 TRPV4: STRUCTURE AND EXPRESSION
 TRPV4: FUNCTIONAL HALLMARKS
 THE TRPV4 PORE
 ACTIVATION MECHANISMS
 POSSIBLE PHYSIOLOGICAL FUNCTIONS...
 REFERENCES
 
TRPV1 (VR-1), the founding member of the TRPV family, was identified by expression cloning as a capsaicin- and heat-gated channel (9). A similar expression cloning strategy for proteins responsible for reabsorption of Ca2+ in the kidney (31) and the gut (63) led to the discovery of TRPV5 (ECaC1) and TRPV6 (CaT1). The remaining three members (TRPV2–4) were identified by using electronic search strategies designed to recognize proteins related to TRPV1 or the related OSM-9 protein from Caenorhabditis elegans (for a detailed review, see Refs. 4, 27). Functionally, the six mammalian members of the TRPV subfamily can be subdivided in two groups: TRPV1 to TRPV4 are Ca2+-permeable, nonselective cation channels with steep temperature dependence; TRPV5 and TRPV6 are highly Ca2+-selective channels with low temperature sensitivity. TRPV channels are also present in invertebrates: C. elegans genome encodes five TRPVs, OCR-1 to OCR-4 and the above-mentioned OSM-9; Drosophila melanogaster expresses two TRPVs.

TRPV1 is an outwardly rectifying cation-selective ion channel with a preference for calcium (PCa/PNa ~ 10) and magnesium (PMg/PNa ~ 5) (9), which depends on a single aspartic acid residue in the pore region of the protein (23). TRPV1 is also activated by moderate heat (>=43°C) and low pH (<=5.9) and may act as an integrator of chemical and physical pain-eliciting stimuli. Gating by heat is direct, whereas mild acidosis (pH < 5.9) reduces the temperature threshold for activation and potentiates the responses to capsaicin (9, 30, 81). Capsaicin and the plant toxin resiniferatoxin are potent exogenous agonists of the vanilloid receptor (77). Endogenous agonists include the cannabinoid receptor agonist anandamide (arachidonoylethanolamide, AEA) and several eicosanoid products of lipoxygenases including 12-(S)- and 15-(S)-hydroperoxyeicosatetraenoic acids, 5-(S)-hydroxyeicosatetraenoic acid, and leukotriene B4 (34, 66, 72, 105). TRPV1 mediates nociception and contributes to the detection and integration of diverse chemical and thermal stimuli (7).

TRPV2 (VRL-1), which is 50% identical to TRPV1, is insensitive to capsaicin and low pH and has a higher threshold for activation by heat (>=52°C) (8).

TRPV3, the last member of the TRPV family to be cloned, is thermosensitive in the physiological temperature range of 22 to 40°C (60, 73, 101).

TRPV4 (OTRPC4, VRL-2, VR-OAC, and TRP12) was first described as a channel activated by hypotonicity-induced cell swelling (42, 55, 74, 99), but it might, as discussed below in more detail, integrate a large variety of stimuli.

TRPV5 (ECaC1, CaT2) and the highly homologous TRPV6 (ECaC2, CaT1) were identified via an expression cloning strategy screening for Ca2+ influx-promoting genes in Xenopus oocytes, using cDNA libraries from rabbit distal tubule kidney cells and rat duodenum, respectively. Both proteins share ~80% homology at the amino acid level (6165), are functionally very similar, and are able to form functional heterotetramers (32). TRPV5 and TRPV6 are highly Ca2+ selective (PCa/PNa > 100) and display anomalous mole fraction behavior, Mg2+ block, and Ca2+-dependent feedback inhibition (54, 8688). All these properties are linked to a single negatively charged aspartic acid residue in the pore region (D542 in TRPV5, D541 in TRPV6) (56).


    TRPV4: STRUCTURE AND EXPRESSION
 TOP
 ABSTRACT
 THE TRPV SUBFAMILY
 TRPV4: STRUCTURE AND EXPRESSION
 TRPV4: FUNCTIONAL HALLMARKS
 THE TRPV4 PORE
 ACTIVATION MECHANISMS
 POSSIBLE PHYSIOLOGICAL FUNCTIONS...
 REFERENCES
 
Within the TRPV subfamily, TRPV4 displays significantly stronger homology with TRPV1–TRPV3 than with TRPV5 and TRPV6 (Fig. 1). Species differences for TRPV4 are minimal (human/mouse 95.2/96.9%; human/rat 94.8/97.0%, mouse/rat 98.9/99.2% identity/similarity). TRPV4 consists of 871 amino acids with at least three ankyrin repeats in the NH2 terminus (Fig. 2).



View larger version (29K):
[in this window]
[in a new window]
 
Fig. 1. The TRPV family. A: dendrogram of the TRPV family, based on homology (data obtained from Vector NT, pairwise comparison). Accession nos. are NP_542437 [GenBank] (hTRPV1), NP_057197 [GenBank] (hTRPV2), AF 514998.1 (hTRPV3), NP_067638 [GenBank] (hTRPV4), NM_019841 [GenBank] (hTRPV5), and NP_06116 (hTRPV6). Phylogenetic distance was calculated using the Neighbor Joining method (Vector NTI 8). B: identity (red) and similarity (black) of the human TRPV (hTRPV) members. C: putative domain structure of m(h)TRPV4. Indicated are putative PKC (blue triangles) and PKA phosphorylation sites (pink triangle), ankyrin binding repeats (ANK), the 6 transmembrane regions (TM1–TM6), a glycosylation site close to the pore (red triangle), and the pore region (see also Fig. 5). Red arrow indicates a Ca2+/calmodulin binding site; aa, amino acid. A tyrosine kinase site is present in the first ankyrin repeat (Y253, not shown).

 


View larger version (53K):
[in this window]
[in a new window]
 
Fig. 2. Sequence of mTRPV4 (accession no. NP_071300 [GenBank] ) with the ankyrin binding repeats underlined in black and TM1–TM6 marked with red bars above the amino acid code. The pore region is indicated in blue type and the calmodulin binding site in red type.

 



View larger version (42K):
[in this window]
[in a new window]
 
Fig. 5. Alignment of the putative TRPV4 pore region with that of other TRPV channels and of the potassium channel KcsA. Transmembrane topology of TRPV channels (top) and alignment of their putative pore region with the bacterial potassium channel KcsA (bottom) are shown. Box marks the region with the highest homology among TRPV1, TRPV2, and TRPV4, supposedly the selectivity filter. Negatively charged residues and the crucial determinants for TRPV4 permeation within this region are in bold type, and those for TRPV4 are underlined. D672 and D682 in TRPV4 are indicated. GenBank accession nos. are CAC 20703 (TRPV4), CAB 89866 (TRPV1), NP_057197 [GenBank] (TRPV2), NP_062815 [GenBank] (TRPV5), AAG 41951 (TRPV6), and PIR S60172 [GenBank] (KcsA). A, ankyrin binding repeats.

 

TRPV4 is expressed in a broad range of tissues, including lung, spleen, kidney, testis, fat, brain, cochlea, skin, smooth muscle, liver, and vascular endothelium (10, 18, 37, 42, 74, 99). In situ hybridization in the brain indicates expression, in the lamina terminalis of the mouse brain, in neurons of the arched vascular organ of the lamina terminalis, in the median preoptic area, the optic chiasm, neurons of the subfornical organ, the ventral hippocampal commissure, anterior hypothalamic structures, ependymal cells of the choroid plexus in the lateral ventricles, and dorsal root ganglia (DRG) neurons (14, 42, 74). Interestingly, TRPV4 mRNA but not the protein could be detected in the soma of DRG neurons, suggesting that there might exist a mechanism for the transport of the TRPV4 protein from the neuronal bodies to the sensory terminals (26). Direct functional measurement of endogenous TRPV4-mediated Ca2+ entry and/or whole cell currents have been described so far only for endothelial cells (94, 96, 97), keratinocytes (10), and DRG neurons (2).


    TRPV4: FUNCTIONAL HALLMARKS
 TOP
 ABSTRACT
 THE TRPV SUBFAMILY
 TRPV4: STRUCTURE AND EXPRESSION
 TRPV4: FUNCTIONAL HALLMARKS
 THE TRPV4 PORE
 ACTIVATION MECHANISMS
 POSSIBLE PHYSIOLOGICAL FUNCTIONS...
 REFERENCES
 
The exogenous agonist 4{alpha}-phorbol 12,13-didecanoate (4{alpha}PDD) activates a large current in TRPV4-expressing cells (Fig. 3, A–C), which is transient in the presence of Ca2+ (Fig. 3A) and shows a complex time course comprising potentiation, subsequent inhibition by higher [Ca2+]i, and desensitization of the agonist response (see below). In the absence of Ca2+, the current decays more slowly (Fig. 3, D–F). Clearly resolvable inward currents can be measured with Ca2+ or Mg2+ as the only permeating extracellular cation, demonstrating that both divalent cations can permeate TRPV4 channels. Permeability values relative to Na+ are 6–10 for Ca2+ and 2–3 for Mg2+ (42, 55, 74, 75, 91, 94). Current-voltage relationships display slight outward rectification in the presence of extracellular Ca2+ and reverse at a positive potential. Outward rectification is also evident at the single-channel level (Fig. 4). Single-channel conductance is 90–100 pS for outward currents and 50–60 pS for inward currents (74, 75, 96, 97). Ruthenium red (RR) reversibly inhibits inward but not outward currents (Fig. 3, G–I).



View larger version (28K):
[in this window]
[in a new window]
 
Fig. 3. Activation of TRPV4 by 4{alpha}-phorbol 12,13-didecanoate (4{alpha}PDD). A: at a holding current of 0 mV, application of 1 µM 4{alpha}PDD induced an inward current (I) that typically appeared with some delay and rapidly inactivated in the presence of extracellular Ca2+. B: time course of currents at +80 ({bullet}) and –80 mV ({circ}) measured from repetitively applied voltage ramps from –100 to +100 mV (holding potential 0 mV). C: current-voltage (I-V) relationships measured at times indicated by a and b in B. Note the outward rectification in the presence of extracellular Ca2+. D: same protocol as in A, at holding current of 0 mV, but in the absence of extracellular Ca2+. Note the delayed inactivation. E: time course of currents activated by 4{alpha}PDD at +80 and –80 mV. F: I-V curves at times labeled c and d in E. Note the near absence of rectification in Ca2+-free solution. G: inhibition of currents through TRPV4 by ruthenium red (RR; 1 µM). Inward currents were completely blocked (holding current 0 mV). After RR was washed out, a large inward current appeared. H: current traces at +80 and –80 mV. Note that in the presence of RR, 4{alpha}PDD activated an outward current but no inward current, indicating a voltage-dependent block of TRPV4 by RR. The inward current appeared after RR was washed out. I: I-V curves at times labeled e–g in H. Block by RR is shown by trace f. Note the absence of the inward current (compare with C). However, after RR was washed out, the typical outwardly rectifying I-V curve reappeared [1.5 mM extracellular [Ca2+] ([Ca2+]e) present].

 


View larger version (31K):
[in this window]
[in a new window]
 
Fig. 4. Single-channel currents through TRPV4 activated by 4{alpha}PDD. A: cell-attached patch (+60 mV, 1.5 mM [Ca2+]e, 1 µM 4{alpha}PDD). Single-channel activity and amplitude histogram (top) are shown from the sweep labeled with a star (bottom), showing the time course of open probability (averaged current per sweep divided by single-channel current). Single-channel current was 3.7 pA. B: single TRPV4 channels at different potentials activated by 1 µM 4{alpha}PDD. C: single-channel current-voltage (i-V) relationship from more than 5 patches per voltage. From linear regressions, an inward conductance of 60 pS and outward conductance of 102 pS were calculated (currents from amplitude histograms).

 


    THE TRPV4 PORE
 TOP
 ABSTRACT
 THE TRPV SUBFAMILY
 TRPV4: STRUCTURE AND EXPRESSION
 TRPV4: FUNCTIONAL HALLMARKS
 THE TRPV4 PORE
 ACTIVATION MECHANISMS
 POSSIBLE PHYSIOLOGICAL FUNCTIONS...
 REFERENCES
 
The ultimate proof that a membrane protein forms a functional channel is the identification of its pore and experimental evidence about mutations in the putative pore region that alter permeation properties. Significant progress in the identification of the molecular determinants of TRP channel pores has been achieved for TRPV1, TRPV4, TRPV5, and TRPV6 channels (23, 32, 56, 8991). For these channels, point mutations have been described in the linker between TM5 and TM6 that affect Ca2+ selectivity, relative monovalent permeability, and blocker sensitivity, providing convincing evidence that, as in the other six TM channels, this linker forms the pore loop containing the selectivity filter.

Figure 5 shows an amino acid sequence alignment of the putative pore regions of the six mammalian TRPV channels, illustrating the high sequence conservation for TRPV1–4. Interestingly, there is also significant homology with the residues in and surrounding the selectivity filter of the KcsA potassium channel, the so-called K+ channel "signature sequence" (TXXTXGYGD) (17, 103). The sequence similarities may indicate conserved pore structures for these cation channels. The GYG motif in the pore of the K+-selective channel is changed into a GMG motif for TRPV1, -2, and -4 and a GLG motif for TRPV3. This difference between TRPV1, -2, and -4 on one hand and TRPV3 on the other hand might explain the remarkably higher single-channel conductance of TRPV3 (172 pS at +60 mV vs. ~100 pS for TRPV1, -2 and -4) (101).

The aspartate residue D682 is an important determinant of the Ca2+ sensitivity of the TRPV4 pore (Fig. 6). Neutralizing this aspartate to alanine causes a moderate reduction of the relative permeability for divalent cations and of the degree of outward rectification, without significantly altering monovalent permeability. Neutralizing D672 has only minor effects, whereas neutralization of both aspartates causes a much stronger reduction of Ca2+ permeability and channel rectification than D682 alone and shifts the permeability sequence for monovalent cations from Eisenman IV to I. Moreover, neutralizing D682 but not D672 strongly reduces the channel's affinity for RR (Fig. 7). In contrast, neutralization of the only positively charged residue in the putative pore region, K675, has no obvious effects on the properties of the TRPV4 channel pore. Interestingly, a mutation to M680 in the region of the K+ channel signature sequence, which is likely an equivalent of the GYG motif in K+ channels, strongly reduces whole cell current amplitude and impairs Ca2+ permeation. Therefore, it is reasonable to speculate that these mutated residues form part of the TRPV4 selectivity filter and that the architecture of the TRPV4 pore is comparable to that of K+ channels.



View larger version (24K):
[in this window]
[in a new window]
 
Fig. 6. Functional properties of the TRPV4 pore. A: I-V curve of whole cell currents normalized to +100 mV in the presence of different [Ca2+]e. Note the Ca2+-dependent outward rectification representing the low-affinity block of inward currents through TRPV4 by [Ca2+]e. B: the double aspartate mutation D672A-D682A in the pore region strongly reduced the Ca2+-dependent block of inward current. C: Ca2+ block represented as ratio of the current at –100 and +100 mV. Concentration for half-maximal block of the wild-type channel was 765 µM [Ca2+]e. Note that the pore mutations D682A or the double aspartate mutations, but not the mutation of D672 alone, decreased the low-affinity block by Ca2+. These results indicate a low-affinity binding of Ca2+ in the TRPV4 pore, which is mainly determined by D682.

 


View larger version (20K):
[in this window]
[in a new window]
 
Fig. 7. Block of TRPV4 by RR. A: currents are shown through wild-type (WT) TRPV4. Channels were activated by 1 µM 4{alpha}PDD. Holding potential was +20 mV. The voltage protocol consisted of a hyperpolarizing prestep to –100 mV, followed by test steps from –100 to +80 mV spaced by 20 mV and a further step back to –100 mV (see B, inset; [Na+]e = 150 mM, [Ca2+]e = 5 mM). The slow decay of the inward current is likely due to inhibition by Ca2+. B: 1 µM RR completely abolished the inward current but did not affect the outward currents in WT TRPV4 channels. This again indicates that the block of TRPV4 by RR is voltage dependent. C: the double mutant D672A-D682A currents are similar to those for the WT; however, the Ca2+-dependent decay was delayed. D: RR had much less effect on the mutant channel than on the WT. Inward currents were still large and decayed slowly, probably due to the slower entrance of RR into the pore vestibule. E: voltage dependence of the block by 1 µM RR for WT TRPV4 and the 3 mutants. The voltage at the abscissa is the test potential after the first step to –100 mV. The unblocked fraction in the presence of RR was obtained by measuring peak tail currents during the second step to –100 mV and normalizing them to the current in the absence of the blocker (see also Ref. 91).

 


    ACTIVATION MECHANISMS
 TOP
 ABSTRACT
 THE TRPV SUBFAMILY
 TRPV4: STRUCTURE AND EXPRESSION
 TRPV4: FUNCTIONAL HALLMARKS
 THE TRPV4 PORE
 ACTIVATION MECHANISMS
 POSSIBLE PHYSIOLOGICAL FUNCTIONS...
 REFERENCES
 
Synthetic TRPV4 agonists. Although TRPV4 was originally considered to be a channel activated upon hypotonic cell swelling, functional characterization of the channel was greatly advanced by the discovery that the synthetic 4{alpha}PDD acts as a robust and direct channel activator. This phorbol ester, which has only weak PKC-activating potency (ED50 > 25 µM) and does not activate TRPV1 or other TRPV channels, is the most potent known activator of TRPV4 with an ED50 of 200–400 nM (94). The phorbol 12,13-didecanoate 20-homovanillate phorbol-vanillate (PDDHV), a potent activator of TRPV1 (78), fails to activate TRPV4 channels in inside-out patches. However, PDDHV activates TRPV4 currents in whole cell recordings and also increases [Ca2+]i, suggesting that its vanillyl moiety has to be cleaved by intracellular esterases (Watanabe H, Vriens J, and Nilius B, unpublished observations). The TRPV4 current activated by 4{alpha}PDD is transient, and repetitive applications result in decreased responses, indicative of desensitization. The classic PKC activator phorbol 12-myristate 13-acetate (PMA), which is structurally similar to 4{alpha}PDD, displays a 10- to 50-fold lower potency than 4{alpha}PDD in activating TRPV4 channels (94). These data strongly suggest that 4{alpha}PDD acts via a mechanism distinct from the classic interaction of a phorbol 12,13-diester with a phorbol ester/diacylglycerol-type receptor target. The 4{alpha} configuration is apparently not essential for channel activation, because 4{beta}PDD also activates TRPV4 in a similar concentration range (Watanabe H and Nilius B, unpublished observation; see also Fig. 8). TRPV4 does not contain a typical cysteine-rich phorbol-binding site, homologous to the C1 domains described for PKC and "nonkinase" phorbol ester receptors (40), and it is therefore unlikely that activation results from binding of 4{alpha}PDD to such a site. In addition, the region of best alignment with several PKCs, chimerins, and MUNC13 has very low homology and is located in the pore region (650H-699C), which makes it unlikely that phorbols are bound via a known motif to TRPV4.



View larger version (26K):
[in this window]
[in a new window]
 
Fig. 8. Comparison of the pharmacology of activation of TRPV1 and TRPV4 by phorbols and fatty acids. Shown are the structures of agonists for TRPV1 and TRPV4. TRPV1 agonists seem to require the vanillyl moiety. For the phorbols, the 4{alpha} vs. 4{beta} structure is indicated by a dashed and solid triangle, respectively. Kd values for TRPV1 are from Ref. 77, and values for TRPV4 are from Refs. 94 and 96 and from Watanabe H and Nilius B [unpublished data for 4{beta}PDD and 4{beta}-12,13-didecanoate 20-homovanillate phorbol-vanillate (PDDHV); 4{alpha}PMA has not yet been tested].

 

Endogenous TRPV4 agonists. The potent activation of TRPV4 by 4{alpha}PDD fueled the search for possible endogenous TRPV4 agonists. Endocannabinoids are a class of endogenous lipids, including amides and esters of long-chain polyunsaturated fatty acids (15, 16, 45) that activate metabotropic cannabinoid receptors. The endocannabinoid anandamide (AEA) and the metabolite 12-hydroxyeicosatetraenoic acid are potent activators of TRPV1 (27, 72, 82, 104, 105). Recently, AEA and its metabolite arachidonic acid (AA) were found to cause a robust increase in intracellular Ca2+ and activate typical whole cell currents in TRPV4-expressing cells (96). AEA and the related endocannabinoid 2-arachydonyl glycerol (2-AG) (45) are transported into the cell through the action of a membrane transporter and degraded via a lipoxygenase. AEA is hydrolyzed to AA exclusively by fatty acid amidohydrolase (FAAH) (13, 15), whereas 2-AG can also be hydrolyzed through monoacylglycerol lipase and other esterases (84). Methanandamide, a nonmetabolizable analog of AEA, is not able to activate TRPV4, and phenylmethylsulfonyl fluoride, a selective FAAH inhibitor, inhibits the effects of AEA but not of AA, indicating that FAAH-dependent hydrolysis of AEA to AA is required for TRPV4 activation (96). Surprisingly, AA is not able to activate TRPV4 in cell free patches, indicating that cellular metabolism of AA is required for channel activation. ETYA, a nonspecific blocker of all AA-metabolizing enzymes (19, 71), prevents activation of TRPV4 currents by AA, which indicates that lipoxygenase (LOX), cyclooxygenase (COX), and cytochrome P-450 (CYP) metabolites of AA might act as potential activators of TRPV4 (96). Activation of TRPV4 by AA was insensitive to indomethacin, nordihydroguaiaretic acid, and a combination of these inhibitors, which ruled out an involvement of the COX and LOX pathways. Miconazole, an inhibitor of P-450 epoxygenase, and 17-octadecynoic acid (17-ODYA), an inhibitor of the P-450 epoxygenase and {omega}/{omega}-1-hydroxylases (71), both fully abolished the AA activation of TRPV4 (96). Importantly, the CYP inhibitors ETYA, miconazole, and 17-ODYA do not directly inhibit TRPV4 channels, because they can still be activated by 4{alpha}PDD in the presence of these blockers. Given that 5',6'-epoxyeicosatrienoic acid (EET) and, to a lesser extent, 8',9'-EET activate TRPV4 in a membrane-delimited fashion, it is most likely that the epoxygenase pathway is involved in TRPV4 activation. Thus AEA and AA apparently act as endogenous chemical agonists of TRPV4, activating the channels through CYP-dependent formation of 5',6'-EET (96). It is unclear whether these endogenous ligands can directly bind to the channel. Activation of TRPM2 by AA depends on an ISXXTKE arachidonate recognition sequence (ARS) (28) that was first shown to be important for AA signaling in the two-pore-domain potassium channel TREK-1 (58). Such an ARS-like sequence, LSRKFKD, is present at the TRPV4 COOH-terminal end of the NH2 terminus (amino acids 402–408 in mTRPV4). Its role in the activation of TRPV4 is unclear because the corresponding deletion mutant could not be functionally expressed (Vriens J, Prenen J, and Nilius B, unpublished observations).

TRPV4 activation by osmosensation and mechanical stimuli. Senses based on mechanosensation include hearing and balance mediated by mechanosensors of the inner ear hair cells and cutaneous touch sensation via the terminals of sensory cells that innervate the skin (22). Changes in cell volume affect other mechanosensors, e.g., osmosensitive neurosensory cells in the circumventricular organs measure the osmolality of the blood and communicate with neurosecretory cells, leading to the secretion of antidiuretic hormone (6). TRPV4 can be activated by exposing cells to hypotonicity, implying that this channel might be a cellular osmosensor (42, 55, 74, 99). The expression of TRPV4 in epithelial cells of kidney, in the stria vascularis of the cochlea, in sweat glands, and in the osmosensory cells of the brain's circumventricular organs (14, 26, 42, 51, 74), is in agreement with such an osmosensor function.

Presently, the mechanism whereby swelling activates TRPV4 is not yet fully solved. The NH2-terminal intracellular domain of TRPV4 contains three or more ankyrin repeat domains that seem to be involved in responses to physical challenges, because TRPV4 activation is delayed if these ankyrin repeats are lacking (42) (Vriens J and Nilius B, unpublished observations). These repeats may anchor the channel to the cytoskeleton and form a mechanical link for gating. A different mechanism of hypotonicity-induced activation of TRPV4 proceeding via the phosphorylation of TRPV4 has been proposed recently (100). These authors observed in a heterologous expression model and in native murine distal convoluted tubule cells in culture a rapid cell swelling-induced tyrosine phosphorylation of TRPV4 mediated via a Lyn kinase-dependent phosphorylation of residue Y253 in the first ankyrin binding repeat. Mutation of this site abolished the hypotonicity-dependent activation of TRPV4. This mechanism is, however, controversial. We did not observe any effect on the swelling-induced response in the Y253F mutant (91a). An alternative possibility could be that hypotonic activation of TRPV4 acts through the above-described AA-EET-dependent pathway, downstream of swelling-induced, PLA2-dependent AA release (3, 59).

Activation by heat. An emerging characteristic of TRPV channels is their distinct response to changes in temperature. TRPV1 is activated at temperatures above 42°C and shows a slight sensitization during repeated stimulations (8, 38). The temperature threshold for TRPV3 activation is about 39°C, but this channel shows strong sensitization during repetitive heat challenges (60, 73, 101). TRPV4 is activated at temperatures above ~27°C. In contrast to TRPV1 and TRPV3, it desensitizes upon repeated heat applications (26, 97). When constantly exposed to 37°C, TRPV4 can still respond to increased temperatures, i.e., its shows incomplete desensitization (26). Likely, TRPV4 is constitutively active at body temperature. Ca2+-dependent inactivation is a possible adaptive mechanism to reduce channel open probability by the resulting increase in [Ca2+]i (94, 95) (see also Modulation by Ca2+). The mechanism of heat activation of TRPV4 is unclear. However, the observation that heat in contrast to, for example, 4{alpha}PDD or 5',6'-EET does not activate TRPV4 channels in cell-free inside-out patches (10, 95) argues against direct activation and points to an indirect or messenger-mediated mechanism.

Modulation by Ca2+. Intracellular Ca2+ is an important regulator of TRPV4 channels and, depending on the concentration, either potentiates or inhibits channel activity (75, 94, 95). Stimulation with 4{alpha}PDD activates TRPV4 current with a certain latency, followed by inactivation. This decay is accelerated by increasing the extracellular Ca2+ concentration and is delayed in the absence of extracellular Ca2+. The ED50 for intracellular Ca2+-dependent inactivation of TRPV4 is ~400–600 nM (94, 95), but the nature of this Ca2+-dependent negative feedback mechanism has not yet been identified. Inactivation in the presence of extracellular Ca2+ was much slower in a mutant channel with a point mutation in the sixth transmembrane domain (F707A) (95).

An increase in intracellular Ca2+ was shown to first stimulate TRPV4 (75), and TRPV4 currents stimulated by hypotonic solutions or phorbol esters were strongly reduced at all potentials in the absence of extracellular Ca2+. The permeant divalent cations Ba2+ and Sr2+ were less effective than Ca2+ in potentiating TRPV4. This effect depended on an intracellular site in the COOH terminus, to which calmodulin binds in a Ca2+-dependent manner. This site, however, does not affect inactivation. A positively charged {alpha}-helical stretch VGRLRRDRWSSVVPRVV, similar to the COOH-terminal Ca2+/calmodulin-binding motif in TRPV6 and with some similarity to the PKC pseudosubstrate site (52), has been identified in the COOH terminal of TRPV4 starting at position 814 (75). By mutagenesis, it has been shown that this motif is the structural determinant of Ca2+-dependent potentiation (75). The same site seems essential for the spontaneous opening of TRPV4 channels in the absence of any agonist (75). This spontaneous activation might be responsible for the observed elevated Ca2+ levels in nonstimulated TRPV4-expressing cells (42, 74, 96, 97, 99). Interestingly, mutant channels with a single mutation in the COOH terminus of TRPV4 (E797) were constitutively open, i.e., spontaneous activation seemed to be increased (95), suggesting that this site may interfere with Ca2+ binding at the neighboring calmodulin-binding motif.

Modulation by phosphorylation. The mechanism of TRPV1 activation and potentiation by PKC-dependent phosphorylation has been investigated in detail (39, 57, 67, 85). It has recently been shown that PMA, a known activator of PKC, also activates TRPV4 (21). Concentrations of PMA that are subthreshold at room temperature (94) activate TRPV4 at 37°C through a PKC-dependent pathway. The PMA activation of TRPV4 is dramatically reduced in the presence of the PKC inhibitors calphostin C and staurosporine (21), indicating that phorbols activate TRPV4 via PKC-independent and -dependent mechanisms. The potentiating effect of PKC stimulation on TRPV4 activation by other stimuli, such as endogenous agonists, cell swelling, and heat, has not yet been studied in detail. Putative PKC phosphorylation sites are indicated in Fig. 1. Probably, S88, S134, and S528 are the most likely candidates for mediating functional effects.

Remarkably, modulation by lipids, such as phosphatidylinositol 4,5-bisphosphate (PIP2), is still completely unknown for TRPV4. The COOH terminus of TRPV1 contains a modular PIP2 binding site (a cluster of basic residues interspersed by hydrophobic amino acids, e.g., LRSSRVSGRHWKNFALVPLLREASARDRQSAQPEEVYLRQFSS for hTRPV1). Binding of PIP2 to this site causes tonic inhibition of the channels, and PLC-mediated hydrolysis sensitizes the channel for activation by capsaicin, protons, and heat (68). This site, however, is not conserved in TRPV4, but all TRPV4s contain a low-homology site with six basic amino acids between residues 400 and 446 whose possible functional impact is still unknown.

Interference of various stimuli. TRPV4 is coexpressed with TRPV3 in mouse keratinocytes (10). Heat responses were significantly enhanced under hypotonic conditions and inhibited under hypertonic conditions in these cells. 4{alpha}PDD also augmented the responsiveness to heat, i.e., a concentration of 4{alpha}PDD that is subthreshold at room temperature activates TRPV4 at higher temperatures (10, 21). Similar synergistic effects have also been observed for the responses of TRPV1 channels to capsaicin, heat, and protons.

TRPV4 expressed in human embryonic kidney (HEK) cells also clearly shows this stimulus interdependence of activation. At room temperature, activation by hypotonic cell swelling, shear stress, and PKC is modest or absent, but 4{alpha}PDD induces a clear effect. At elevated temperatures (37°C), TRPV4 is rapidly activated by all stimuli. Temperature appears to be a critical modulator of TRPV4 channel gating, leading to activation of the channel by a diverse range of microenvironmental chemical and physical signals (21). It is obvious from these data that the precise threshold for TRPV4 activation depends on the cellular context and environmental history of the channel. Activity-dependent changes in channel state, channel phosphorylation, or dephosphorylation (100); changes in osmolarity; activation of downstream signaling pathways; and protein-protein interactions such as heteromultimeric channel formation may all cause diversity in activation parameters. Heat does not affect the 5',6'-EET-induced increase in [Ca2+]i, but this increase is reduced under hyposmotic conditions (Vriens J and Nilius B, unpublished data). Likely, the heat-sensitive pathway is different from the swelling-induced pathway.


    POSSIBLE PHYSIOLOGICAL FUNCTIONS FOR TRPV4
 TOP
 ABSTRACT
 THE TRPV SUBFAMILY
 TRPV4: STRUCTURE AND EXPRESSION
 TRPV4: FUNCTIONAL HALLMARKS
 THE TRPV4 PORE
 ACTIVATION MECHANISMS
 POSSIBLE PHYSIOLOGICAL FUNCTIONS...
 REFERENCES
 
One key question remains: What are TRPV4 channels good for? The ability of this unique channel to respond to a broad variety of signals has evoked hypotheses about its possible involvement in processes ranging from sensory detection and thermoregulation to regulation of vascular tone and signaling in the brain. At present, most of this is still speculative, but the recent creation of TRPV4-deficient mice will allow a direct testing of these hypotheses.

Keratinocytes are capable of detecting modest temperature elevations, which contribute to warmth perception and/or cutaneous thermoregulation. In a recent study, strong evidence was provided for an involvement of TRPV4 in these responses (10). In addition to peripheral temperature sensing, TRPV4 might also play a role in regulating thermogenesis. TRPV4 is expressed in the preoptic and anterior hypothalamus (26, 42), the control center of thermogenesis that contains specialized warm- and cool-sensitive neurons, which are also activated by hyposmolarity (1, 5, 33, 83). The high level of TRPV4 expression in endothelial cells (94, 97) may hint to another role in thermoregulation by influencing the vasomotor activity of peripheral vessels. The involvement of TRPV4 in thermosensation and thermoregulation might become clearer in mice lacking TRPV4.

The basal level of TRPV4 activity at normal body temperature will undoubtedly contribute to Ca2+ homeostasis and might influence the growth and differentiation state of cells expressing TRPV4. Primary keratinocytes maintain an undifferentiated proliferative phenotype at low extracellular Ca2+, whereas exposure to higher Ca2+ inhibits proliferation, changes cell morphology and induces terminal differentiation (10, 102). In endothelial cells, temperature-sensitive Ca2+ entry through TRPV4 could have important consequences, e.g., for a steady-state production of nitric oxide, and might contribute to the known vasoconstriction and vasodilatation of peripheral blood vessels induced by cooling and warming, respectively (46). In addition, the temperature sensitivity of endothelial TRPV4 might suggest a role in mediating inflammatory pathophysiology in fever, e.g., by changing barrier properties that depend on Ca2+ influx (79).

Until now, TRPV4 is the only TRP channel that has been put forward as a potential constituent of a mammalian mechanotransducer (42), although its biophysical properties do not really match those of a mechanosensitive channel, because pressure applied to TRPV4-expressing cell-attached patches does not activate this channel (74). Nevertheless, it is an interesting possibility that TRPV4 is involved in mechanosensing, e.g., in endothelial cells via a mechanostimulation of PLA2 and subsequent activation by AA and 5',6'-EET (96). Interestingly, TRPV4 responds to shear stress, which might be especially important for endothelial cell function (21, 53). The proposed mechanosensitivity of TRPV4 has also made it a candidate gene for inherited dominant nonsyndromic hearing impairment (25, 27).

The TRPV4 activators AEA and 2-AG likely play an important role in the control of the vascular tone and potentially in shock conditions (44, 69, 70, 92, 93, 105). Interestingly, their effects could not be fully explained by an action on CB1 and CB2 receptors or on TRPV1 channels (24, 29, 35, 36, 92). Our data about the activation of TRPV4 by AEA and 2-AG might provide the missing link for the action of these compounds on endothelium.

Endocannabinoids are potent neuromodulators that may mainly act as retrograde messengers (20, 98). The finding that endocannabinoids are involved in TRPV4 activation identifies a new molecular target for cannabinoids and provides a link to modulation of synaptic function (16). In this respect, it might be of interest that the gene locus for the human TRPV4 channel is associated with bipolar affective disorder (14).

It has been shown that TRPV4 has a physiological role in rat primary afferent neurons and is involved in the detection of osmolarity in nociceptors (2). TRPV4 is thus a sensory transducer for osmotic stimulus-induced nociception. The TRPV4 protein is transported in sensory nerve distally toward the peripheral nerve endings. Single-fiber recordings on C-fibers showed an activation due to a hypotonic stimulus and, in addition, an enhanced production of the hyperalgesic inflammatory mediator prostaglandin E2. It was also shown that this osmotransduction causes nociception and induced pain-related behavior in mice. This is the first report on the role of TRPV4 in pain signaling. Thus we conclude that TRPV4 might be a new target for the development of novel analgesics.

The recently described TRPV4-deficient mouse shows a markedly reduced sensitivity of the tail to pressure and acidic nociception, which is compatible with a role of TRPV4 in mechanosensation. The threshold to noxious stimuli and the conduction velocity of myelinated nerves responding to stimuli were also impaired, indicating that TRPV4 might be essential for the normal detection of pressure by a high-threshold mechanosensor (76). Another functional role of TRPV4 suggested by the Suzuki group is its putative role in osmoregulation (47). TRPV4 is expressed in the cerebral circumventricular organs (42), which is important for regulation of water input and/or osmolarity in the body. In TRPV4-deficient mice, water intake behavior, or serum osmolarity, and serum vasopressin (AVP), were not changed. During short-term salt ingestion, however, serum AVP and AVP secretion were significantly increased. In brain slices, hyperosmolarity exaggerated AVP secretion. It was concluded that TRPV4 might transmit a negative signal for AVP. The underlying mechanism is unclear, because in this case hyperosmolarity might be able to activate TRPV4.

Some clues for the functional role of TRPV4 may be obtained from TRPV subfamily members in C. elegans and Drosophila. OSM-9, one of the five C. elegans TRPV channels, is present in chemosensory and mechanosensory neurons, and OSM-9-deficient worms have defective olfactory and mechanosensory responses (12). Together with other TRPV channels (e.g., OCR-2), OSM-9 is essential for the diverse sensory functions and localized in sensory cilia (80). Importantly, the different C. elegans TRPV channels promote the targeting of each other to cilia. Likely, different combinations of TRPV proteins allow cell type-specific regulation of channel function and localization, and combinations of TRPV proteins may direct different functions to distinct subcellular locations. The D. melanogaster genome includes two predicted TRPV genes (43, 80). One gene encodes an 833-amino acid protein called Nanchung (Nan), which shares several topological hallmarks with TRPV4. Functional expression of Nan results in a Ca2+-permeable channel activated by cell swelling. Nan is exclusively expressed in chordotonal neurons and is localized in the sensory cilia of the Drosophila antennas. Antennal sound-evoked potentials are completely absent in mutants lacking Nan. This TRPV channel therefore acts, at least in Drosophila, as a chordotonal mechanotransducer that is essential for hearing (41).


    ACKNOWLEDGMENTS
 
T. Voets is a Postdoctoral Fellow of the Fund for Scientific Research-Flanders (Belgium). We thank V. Flockerzi (Homburg) and C. D. Benham (GSK Harlow) for continuous support and helpful comments. The experimental work was done with the mTRP12 clone (mTRPV4) kindly provided by V. Flockerzi and U. Wissenbach (Homburg). We thank Hiroyuki Watanabe (Akita) for the unpublished data on phorbol activation of TRPV4 and Gregor Owsianik (Leuven) for many helpful discussions.

GRANTS

This work was supported by the Belgian Federal Government, the Flemish Government, and the Onderzoeksraad KU Leuven (GOA 99/07, F.W.O. G.0213.99, F.W.O. G. 0136.00; F.W.O. G.0172.03, Interuniversity Poles of Attraction Program, IUAP, and CF-Pronet).


    FOOTNOTES
 

Address for reprint requests and other correspondence: B. Nilius, Laboratorium voor Fysiologie, KU Leuven, Campus Gasthuisberg, 3000 Leuven, Belgium (E-mail: Bernd.Nilius{at}med.kuleuven.ac.be).

NOTE ADDED IN PROOF

After acceptance of this paper, the W. Liedtle laboratory published impressive data on the involvement of TRPV4 in osmoregulation. TRPV4-deficient mice drink less water, become more hyperosmolar, have a decreased blood level of antidiuretic hormone, and show an impaired response to hyper- and hyposmolar stimuli. Data indicate that TRPV4 is a necessary osmotic sensor in the circumventricular organs in the mammalian CNS (Liedtke W and Friedman JM. Abnormal osmotic regulation in trpv4/ mice. Proc Natl Acad Sci October 27, 2003; 10.1073/pnas.173541610).


    REFERENCES
 TOP
 ABSTRACT
 THE TRPV SUBFAMILY
 TRPV4: STRUCTURE AND EXPRESSION
 TRPV4: FUNCTIONAL HALLMARKS
 THE TRPV4 PORE
 ACTIVATION MECHANISMS
 POSSIBLE PHYSIOLOGICAL FUNCTIONS...
 REFERENCES
 
1. Abe J, Okazawa M, Adachi R, Matsumura K, and Kobayashi S. Primary cold-sensitive neurons in acutely dissociated cells of rat hypothalamus. Neurosci Lett 342: 29–32, 2003.[CrossRef][Web of Science][Medline]

2. Alessandri-Haber N, Yeh JJ, Boyd AE, Parada CA, Chen X, Reichling DB, and Levine JD. Hypotonicity induces TRPV4-mediated nociception in rat. Neuron 39: 497–511, 2003.[CrossRef][Web of Science][Medline]

3. Basavappa S, Pedersen SF, Jorgensen NK, Ellory JC, and Hoffmann EK. Swelling-induced arachidonic acid release via the 85-kDa cPLA2 in human neuroblastoma cells. J Neurophysiol 79: 1441–1449, 1998.[Abstract/Free Full Text]

4. Benham CD, Davis JB, and Randall AD. Vanilloid and TRP channels: a family of lipid-gated cation channels. Neuropharmacology 42: 873–888, 2002.[CrossRef][Web of Science][Medline]

5. Boulant JA. Role of the preoptic-anterior hypothalamus in thermoregulation and fever. Clin Infect Dis 31, Suppl 5: S157–S161, 2000.[CrossRef][Web of Science][Medline]

6. Bourque CW and Oliet SH. Osmoreceptors in the central nervous system. Annu Rev Physiol 59: 601–619, 1997.[CrossRef][Web of Science][Medline]

7. Caterina MJ, Leffler A, Malmberg AB, Martin WJ, Trafton J, Petersen-Zeitz KR, Koltzenburg M, Basbaum AI, and Julius D. Impaired nociception and pain sensation in mice lacking the capsaicin receptor. Science 288: 306–313, 2000.[Abstract/Free Full Text]

8. Caterina MJ, Rosen TA, Tominaga M, Brake AJ, and Julius D. A capsaicin-receptor homologue with a high threshold for noxious heat. Nature 398: 436–441, 1999.[CrossRef][Medline]

9. Caterina MJ, Schumacher MA, Tominaga M, Rosen TA, Levine JD, and Julius D. The capsaicin receptor: a heat-activated ion channel in the pain pathway. Nature 389: 816–824, 1997.[CrossRef][Web of Science][Medline]

10. Chung MK, Lee H, and Caterina MJ. Warm temperatures activate TRPV4 in mouse 308 keratinocytes. J Biol Chem 278: 32037–32046, 2003.[Abstract/Free Full Text]

11. Clapham DE, Runnels LW, and Strubing C. The trp ion channel family. Nat Rev Neurosci 2: 387–396, 2001.[Web of Science][Medline]

12. Colbert HA, Smith TL, and Bargmann CI. OSM-9, a novel protein with structural similarity to channels, is required for olfaction, mechanosensation, and olfactory adaptation in Caenorhabditis elegans. J Neurosci 17: 8259–8269, 1997.[Abstract/Free Full Text]

13. Cravatt BF, Giang DK, Mayfield SP, Boger DL, Lerner RA, and Gilula NB. Molecular characterization of an enzyme that degrades neuromodulatory fatty-acid amides. Nature 384: 83–87, 1996.[CrossRef][Medline]

14. Delany NS, Hurle M, Facer P, Alnadaf T, Plumpton C, Kinghorn I, See CG, Costigan M, Anand P, Woolf CJ, Crowther D, Sanseau P, and Tate SN. Identification and characterization of a novel human vanilloid receptor-like protein, VRL-2. Physiol Genomics 4: 165–174, 2001.[Abstract/Free Full Text]

15. Di Marzo V, Fontana A, Cadas H, Schinelli S, Cimino G, Schwartz JC, and Piomelli D. Formation and inactivation of endogenous cannabinoid anandamide in central neurons. Nature 372: 686–691, 1994.[CrossRef][Medline]

16. Di Marzo V, Melck D, Bisogno T, and De Petrocellis L. Endocannabinoids: endogenous cannabinoid receptor ligands with neuromodulatory action. Trends Neurosci 21: 521–528, 1998.[CrossRef][Web of Science][Medline]

17. Doyle DA, Morais Cabral J, Pfuetzner RA, Kuo A, Gulbis JM, Cohen SL, Chait BT, and MacKinnon R. The structure of the potassium channel: molecular basis of K+ conduction and selectivity. Science 280: 69–77, 1998.[Abstract/Free Full Text]

18. Fernandez-Fernandez JM, Nobles M, Currid A, Vazquez E, and Valverde MA. Maxi K+ channel mediates regulatory volume decrease response in a human bronchial epithelial cell line. Am J Physiol Cell Physiol 283: C1705–C1714, 2002.[Abstract/Free Full Text]

19. Fleming I. Cytochrome P450 enzymes in vascular homeostasis. Circ Res 89: 753–762, 2001.[Abstract/Free Full Text]

20. Freund TF, Katona I, and Piomelli D. Role of endogenous cannabinoids in synaptic signaling. Physiol Rev 83: 1017–1066, 2003.[Abstract/Free Full Text]

21. Gao X, Wu L, and O'Neil RG. Temperature-modulated diversity of TRPV4 channel gating: activation by physical stresses and phorbol ester derivatives through protein kinase C-dependent and -independent pathways. J Biol Chem 278: 27129–22737, 2003.[Abstract/Free Full Text]

22. Garcia-Anoveros J and Corey DP. The molecules of mechanosensation. Annu Rev Neurosci 20: 567–594, 1997.[CrossRef][Web of Science][Medline]

23. Garcia-Martinez C, Morenilla-Palao C, Planells-Cases R, Merino JM, and Ferrer-Montiel A. Identification of an aspartic residue in the P-loop of the vanilloid receptor that modulates pore properties. J Biol Chem 275: 32552–32558, 2000.[Abstract/Free Full Text]

24. Grainger J and Boachie Ansah G. Anandamide-induced relaxation of sheep coronary arteries: the role of the vascular endothelium, arachidonic acid metabolites and potassium channels. Br J Pharmacol 134: 1003–1012, 2001.[CrossRef][Web of Science][Medline]

25. Greene CC, McMillan PM, Barker SE, Kurnool P, Lomax MI, Burmeister M, and Lesperance MM. DFNA25, a novel locus for dominant nonsyndromic hereditary hearing impairment, maps to 12q21– 24 Am J Hum Genet 68: 254–260, 2001.[CrossRef][Web of Science][Medline]

26. Güler A, Lee H, Shimizu I, and Caterina MJ. Heat-evoked activation of TRPV4 (VR-OAC). J Neurosci 22: 6408–6414, 2002.[Abstract/Free Full Text]

27. Gunthorpe MJ, Benham CD, Randall A, and Davis JB. The diversity in the vanilloid (TRPV) receptor family of ion channels. Trends Pharmacol Sci 23: 183–191, 2002.[CrossRef][Medline]

28. Hara Y, Wakamori M, Ishii M, Maeno E, Nishida M, Yoshida T, Yamada H, Shimizu S, Mori E, Kudoh J, Shimizu N, Kurose H, Okada Y, Imoto K, and Mori Y. LTRPC2 Ca2+-permeable channel activated by changes in redox status confers susceptibility to cell death. Mol Cell 9: 163–173, 2002.[CrossRef][Web of Science][Medline]

29. Harris D, McCulloch AI, Kendall DA, and Randall MD. Characterization of vasorelaxant response to anandamide in the rat mesenteric arterial bed. J Physiol 539: 893–902, 2002.[Abstract/Free Full Text]

30. Hayes P, Meadows HJ, Gunthorpe MJ, Harries MH, Duckworth DM, Cairns W, Harrison DC, Clarke CE, Ellington K, Prinjha RK, Barton AJ, Medhurst AD, Smith GD, Topp S, Murdock P, Sanger GJ, Terrett J, Jenkins O, Benham CD, Randall AD, Gloger IS, and Davis JB. Cloning and functional expression of a human orthologue of rat vanilloid receptor-1. Pain 88: 205–215, 2000.[CrossRef][Web of Science][Medline]

31. Hoenderop JG, van der Kemp AW, Hartog A, van de Graaf SF, van Os CH, Willems PH, and Bindels RJ. Molecular identification of the apical Ca2+ channel in 1, 25-dihydroxyvitamin D3-responsive epithelia. J Biol Chem 274: 8375–8378, 1999.[Abstract/Free Full Text]

32. Hoenderop JGJ, Voets T, Hoefs S, Weidema F, Prenen J, Nilius B, and Bindels RJM. Homo- and heterotetrameric architecture of the epithelial Ca2+ channels TRPV5 and TRPV6. EMBO J 22: 776–785, 2003.[CrossRef][Web of Science][Medline]

33. Hori A, Minato K, and Kobayashi S. Warming-activated channels of warm-sensitive neurons in rat hypothalamic slices. Neurosci Lett 275: 93–96, 1999.[CrossRef][Web of Science][Medline]

34. Hwang SW, Cho H, Kwak J, Lee SY, Kang CJ, Jung J, Cho S, Min KH, Suh YG, Kim D, and Oh U. Direct activation of capsaicin receptors by products of lipoxygenases: endogenous capsaicin-like substances. Proc Natl Acad Sci USA 97: 6155–6160, 2000.[Abstract/Free Full Text]

35. Jarai Z, Wagner JA, Goparaju SK, Wang L, Razdan RK, Sugiura T, Zimmer AM, Bonner TI, Zimmer A, and Kunos G. Cardiovascular effects of 2-arachidonoyl glycerol in anesthetized mice. Hypertension 35: 679–684, 2000.[Abstract/Free Full Text]

36. Jarai Z, Wagner JA, Varga K, Lake KD, Compton DR, Martin BR, Zimmer AM, Bonner TI, Buckley NE, Mezey E, Razdan RK, Zimmer A, and Kunos G. Cannabinoid-induced mesenteric vasodilation through an endothelial site distinct from CB1 or CB2 receptors. Proc Natl Acad Sci USA 96: 14136–14141, 1999.[Abstract/Free Full Text]

37. Jia Y, McLeod RL, Wang X, Parra LE, Egan RW, and Hey JA. Anandamide induces cough in conscious guinea-pigs through VR1 receptors. Br J Pharmacol 137: 831–836, 2002.[CrossRef][Web of Science][Medline]

38. Jordt SE and Julius D. Molecular basis for species-specific sensitivity to "hot" chili peppers. Cell 108: 421–430, 2002.[CrossRef][Web of Science][Medline]

39. Jung J, Lee SY, Hwang SW, Cho H, Shin J, Kang YS, Kim S, and Oh U. Agonist recognition sites in the cytosolic tails of vanilloid receptor 1. J Biol Chem 277: 44448–44454, 2002.[Abstract/Free Full Text]

40. Kazanietz MG. Novel "nonkinase" phorbol ester receptors: the C1 domain connection. Mol Pharmacol 61: 759–767, 2002.[Abstract/Free Full Text]

41. Kim J, Chung DY, Park D, Choix S, Shin DW, Soh H, Lee HW, Son W, Yim J, Park CS, Kernan MJ, and Kim C. A TRPV family ion channel required for hearing in Drosophila. Nature 424: 81–84, 2003.[CrossRef][Medline]

42. Liedtke W, Choe Y, Marti-Renom MA, Bell AM, Denis CS, Sali A, Hudspeth AJ, Friedman JM, and Heller S. Vanilloid receptor-related osmotically activated channel (VR-OAC), a candidate vertebrate osmoreceptor. Cell 103: 525–535, 2000.[CrossRef][Web of Science][Medline]

43. Littleton JT and Ganetzky B. Ion channels and synaptic organization: analysis of the Drosophila genome. Neuron 26: 35–43, 2000.[CrossRef][Web of Science][Medline]

44. Maccarrone M, Bari M, Lorenzon T, Bisogno T, Di Marzo V, and Finazzi-Argo A. Anandamide uptake by human endothelial cells and its regulation by nitric oxide. J Biol Chem 275: 13484–13492, 2000.[Abstract/Free Full Text]

45. Mechoulam R, Fride E, and DiMarzo V. Endocannabinoids. Eur J Pharmacol 359: 1–18, 1998.[CrossRef][Web of Science][Medline]

46. Minson CT, Berry LT, and Joyner MJ. Nitric oxide and neurally mediated regulation of skin blood flow during local heating. J Appl Physiol 91: 1619–1626, 2001.[Abstract/Free Full Text]

47. Mizuno A, Matsumoto N, Imai M, and Suzuki M. Impaired osmotic sensation in mice lacking TRPV4. Am J Physiol Cell Physiol 285: C96–C101, 2003.[Abstract/Free Full Text]

48. Montell C. Physiology, phylogeny, and functions of the TRP superfamily of cation channels. Science's STKE July 10, 2001; 10.1126/stke.2001.90.re1.

49. Montell C, Birnbaumer L, and Flockerzi V. The TRP channels, a remarkable functional family. Cell 108: 595–598, 2002.[CrossRef][Web of Science][Medline]

50. Montell C, Birnbaumer L, Flockerzi V, Bindels RJ, Bruford EA, Caterina MJ, Clapham D, Harteneck C, Heller S, Julius D, Kojima I, Mori Y, Penner R, Prawitt D, Scharenberg AM, Schultz G, Shimizu S, and Zhu MX. A unified nomenclature for the superfamily of TRP cation channels. Mol Cell 9: 229–231, 2002.[CrossRef][Web of Science][Medline]

51. Mutai H and Heller S. Vertebrate and invertebrate TRPV-like mechanoreceptor. Cell Calcium 33: 471–478, 2003.[CrossRef][Web of Science][Medline]

52. Niemeyer BA, Bergs C, Wissenbach U, Flockerzi V, and Trost C. Competitive regulation of CaT-like-mediated Ca2+ entry by protein kinase C and calmodulin. Proc Natl Acad Sci USA 98: 3600–3605, 2001.[Abstract/Free Full Text]

53. Nilius B, Droogmans G, and Wondergem R. TRP channels in endothelium: solving the calcium entry puzzle? Endothelium 10: 5–15, 2003.[CrossRef][Web of Science][Medline]

54. Nilius B, Prenen J, Hoenderop JG, Vennekens R, Hoefs S, Weidema AF, Droogmans G, and Bindels RJ. Fast and slow inactivation kinetics of the Ca2+ channels ECaC1 and ECaC2 (TRPV5 and TRPV6). Role of the intracellular loop located between transmembrane segments 2 and 3. J Biol Chem 277: 30852–30858, 2002.[Abstract/Free Full Text]

55. Nilius B, Prenen J, Wissenbach U, Bodding M, and Droogmans G. Differential activation of the volume-sensitive cation channel TRP12 (OTRPC4) and volume-regulated anion currents in HEK-293 cells. Pflügers Arch 443: 227–233, 2001.[CrossRef][Web of Science][Medline]

56. Nilius B, Vennekens R, Prenen J, Hoenderop JG, Droogmans G, and Bindels RJ. The single pore residue Asp542 determines Ca2+ permeation and Mg2+ block of the epithelial Ca2+ channel. J Biol Chem 276: 1020–1025, 2001.[Abstract/Free Full Text]

57. Olah Z, Karai L, and Iadarola MJ. Protein kinase C{alpha} is required for vanilloid receptor 1 activation. Evidence for multiple signaling pathways. J Biol Chem 277: 35752–35759, 2002.[Abstract/Free Full Text]

58. Patel AJ, Honore E, Maingret F, Lesage F, Fink M, Duprat F, and Lazdunski M. A mammalian two pore domain mechano-gated S-like K+ channel. EMBO J 17: 4283–4290, 1998.[CrossRef][Web of Science][Medline]

59. Pedersen S, Lambert IH, Thoroed SM, and Hoffmann EK. Hypotonic cell swelling induces translocation of the {alpha} isoform of cytosolic phospholipase A2 but not the {gamma} isoform in Ehrlich ascites tumor cells. Eur J Biochem 267: 5531–5539, 2000.[Web of Science][Medline]

60. Peier AM, Reeve AJ, Andersson DA, Moqrich A, Earley TJ, Hergarden AC, Story GM, Colley S, Hogenesch JB, McIntyre P, Bevan S, and Patapoutian A. A heat-sensitive TRP channel expressed in keratinocytes. Science 296: 2046–2049, 2002.[Abstract/Free Full Text]

61. Peng JB, Brown EM, and Hediger MA. Structural conservation of the genes encoding CaT1, CaT2, and related cation channels. Genomics 76: 99–109, 2001.[CrossRef][Web of Science][Medline]

62. Peng JB, Chen XZ, Berger UV, Vassilev PM, Brown EM, and Hediger MA. A rat kidney-specific calcium transporter in the distal nephron. J Biol Chem 275: 28186–28194, 2000.[Abstract/Free Full Text]

63. Peng JB, Chen XZ, Berger UV, Vassilev PM, Tsukaguchi H, Brown EM, and Hediger MA. Molecular cloning and characterization of a channel-like transporter mediating intestinal calcium absorption. J Biol Chem 274: 22739–22746, 1999.[Abstract/Free Full Text]

64. Peng JB, Chen XZ, Berger UV, Weremowicz S, Morton CC, Vassilev PM, Brown EM, and Hediger MA. Human calcium transport protein CaT1. Biochem Biophys Res Commun 278: 326–332, 2000.[CrossRef][Web of Science][Medline]

65. Peng JB and Hediger MA. A family of calcium-permeable channels in the kidney: distinct roles in renal calcium handling. Curr Opin Nephrol Hypertens 11: 555–561, 2002.[CrossRef][Web of Science][Medline]

66. Piomelli D. The ligand that came from within. Trends Pharmacol Sci 22: 17–19, 2001.[CrossRef][Medline]

67. Premkumar LS and Ahern GP. Induction of vanilloid receptor channel activity by protein kinase C. Nature 408: 985–990, 2000.[CrossRef][Medline]

68. Prescott ED and Julius D. A modular PIP2 binding site as a determinant of capsaicin receptor sensitivity. Science 300: 1284–1288, 2003.[Abstract/Free Full Text]

69. Randall MD and Kendall DA. Anandamide and endothelium-derived hyperpolarizing factor act via a common vasorelaxant mechanism in rat mesentery. Eur J Pharmacol 346: 51–53, 1998.[CrossRef][Web of Science][Medline]

70. Randall MD and Kendall DA. Endocannabinoids: a new class of vasoactive substances. Trends Pharmacol Sci 19: 55–58, 1998.[CrossRef][Medline]

71. Roman RJ. P-450 metabolites of arachidonic acid in the control of cardiovascular function. Physiol Rev 82: 131–185, 2002.[Abstract/Free Full Text]

72. Smart D, Gunthorpe MJ, Jerman JC, Nasir S, Gray J, Muir AI, Chambers JK, Randall AD, and Davis JB. The endogenous lipid anandamide is a full agonist at the human vanilloid receptor (hVR1). Br J Pharmacol 129: 227–230, 2000.[CrossRef][Web of Science][Medline]

73. Smith GD, Gunthorpe J, Kelsell RE, Hayes PD, Reilly P, Facer P, Wright JE, Jerman JC, Walhin JP, Ooi L, Egerton J, Charles KJ, Smart D, Randall AD, Anand P, and Davis JB. TRPV3 is a temperature-sensitive vanilloid receptor-like protein. Nature 418: 186–190, 2002.[CrossRef][Medline]

74. Strotmann R, Harteneck C, Nunnenmacher K, Schultz G, and Plant TD. OTRPC4, a nonselective cation channel that confers sensitivity to extracellular osmolarity. Nat Cell Biol 2: 695–702, 2000.[CrossRef][Web of Science][Medline]

75. Strotmann R, Schultz G, and Plant TD. Ca2+-dependent potentiation of the nonselective cation channel TRPV4 is mediated by a carboxy terminal calmodulin binding site. J Biol Chem 278: 26541–26549, 2003.[Abstract/Free Full Text]

76. Suzuki M, Mizuno A, Kodaira K, and Imai M. Impaired pressure sensation with mice lacking TRPV4. J Biol Chem 270: 22664–22668, 2003.

77. Szallasi A and Blumberg PM. Vanilloid (capsaicin) receptors and mechanisms. Pharmacol Rev 51: 159–212, 1999.[Abstract/Free Full Text]

78. Szallasi A, Szabo T, Biro T, Modarres S, Blumberg PM, Krause JE, Cortright DN, and Appendino G. Resiniferatoxin-type phorboid vanilloids display capsaicin-like selectivity at native vanilloid receptors on rat DRG neurons and at the cloned vanilloid receptor VR1. Br J Pharmacol 128: 428–434, 1999.[CrossRef][Web of Science][Medline]

79. Tiruppathi C, Freichel M, Vogel SM, Paria BC, Mehta D, Flockerzi V, and Malik AB. Impairment of store-operated Ca2+ entry in TRPC4–/– mice interferes with increase in lung microvascular permeability. Circ Res 91: 70–76, 2002.[Abstract/Free Full Text]

80. Tobin DM, Madsen DM, Kahn Kirby A, Peckol EL, Moulder G, Barstead R, Maricq AV, and Bargmann CI. Combinatorial expression of TRPV channel proteins defines their sensory functions and subcellular localization in C. elegans neurons. Neuron 35: 307–318, 2002.[CrossRef][Web of Science][Medline]

81. Tominaga M, Caterina MJ, Malmberg AB, Rosen TA, Gilbert H, Skinner K, Raumann BE, Basbaum AI, and Julius D. The cloned capsaicin receptor integrates multiple pain-producing stimuli. Neuron 21: 531–543, 1998.[CrossRef][Web of Science][Medline]

82. Toth A, Kedei N, Wang Y, and Blumberg PM. Arachidonyl dopamine as a ligand for the vanilloid receptor VR1 of the rat. Life Sci 73: 487–498, 2003.[CrossRef][Web of Science][Medline]

83. Travis KA, Bockholt HJ, Zardetto Smith AM, and Johnson AK. In vitro thermosensitivity of the midline thalamus. Brain Res 686: 17–22, 1995.[CrossRef][Web of Science][Medline]

84. Ueda N. Endocannabinoid hydrolases. Prostaglandins Other Lipid Mediat 68–69: 521–534, 2002.

85. Vellani V, Mapplebeck S, Moriondo A, Davis JB, and McNaughton PA. Protein kinase C activation potentiates gating of the vanilloid receptor VR1 by capsaicin, protons, heat and anandamide. J Physiol 534: 813–825, 2001.[Abstract/Free Full Text]

86. Vennekens R, Hoenderop JG, Prenen J, Stuiver M, Willems PH, Droogmans G, Nilius B, and Bindels RJ. Permeation and gating properties of the novel epithelial Ca2+ channel. J Biol Chem 275: 3963–3969, 2000.[Abstract/Free Full Text]

87. Vennekens R, Prenen J, Hoenderop JG, Bindels RJ, Droogmans G, and Nilius B. Modulation of the epithelial Ca2+ channel ECaC by extracellular pH. Pflügers Arch 442: 237–242, 2001.[CrossRef][Web of Science][Medline]

88. Vennekens R, Prenen J, Hoenderop JG, Bindels RJ, Droogmans G, and Nilius B. Pore properties and ionic block of the rabbit epithelial calcium channel expressed in HEK 293 cells. J Physiol 530: 183–191, 2001.[Abstract/Free Full Text]

89. Voets T, Janssens A, Prenen J, Droogmans D, and Nilius G. Mg2+-dependent gating and strong inward rectification of the cation channel TRPV6. J Gen Physiol 121: 245–260, 2003.[Abstract/Free Full Text]

90. Voets T, Prenen J, Fleig A, Vennekens R, Watanabe H, Hoenderop JGJ, Bindels RJM, Droogmans G, Penner R, and Nilius B. CaT1 and the calcium release-activated calcium channel manifest distinct pore properties. J Biol Chem 276: 47767–47770, 2001.[Abstract/Free Full Text]

91. Voets T, Prenen J, Vriens J, Watanabe H, Janssens A, Wissenbach U, Bödding M, Droogmans G, and Nilius B. Molecular determinants of permeation through the cation channel TRPV4. J Biol Chem 277: 33704–33710, 2002.[Abstract/Free Full Text]

91. Vriens J, Watanabe H, Janssens A, Droogmans G, Voets T, and Nilius B. Cell swelling, heat and chemical agonists use distinct pathways for the activation of the cation channel TRPV4. Proc Natl Acad Sci USA. In press.

92. Wagner JA, Varga K, Jarai Z, and Kunos G. Mesenteric vasodilation mediated by endothelial anandamide receptors. Hypertension 33, Suppl S: 429–434, 1999.[Abstract/Free Full Text]

93. Wagner JA, Varga K, and Kunos G. Cardiovascular actions of cannabinoids and their generation during shock. J Mol Med 76: 824–836, 1998.[CrossRef][Web of Science][Medline]

94. Watanabe H, Davis JB, Smart D, Jerman JC, Smith GD, Hayes P, Vriens J, Cairns W, Wissenbach U, Prenen J, Flockerzi V, Droogmans G, Benham CD, and Nilius B. Activation of TRPV4 channels (hVRL-2/mTRP12) by phorbol derivatives. J Biol Chem 277: 13569–13577, 2002.[Abstract/Free Full Text]

95. Watanabe H, Vriens J, Janssens A, Wondergem R, Droogmans G, and Nilius B. Modulation of TRPV4 gating by intra- and extracellular Ca2+. Cell Calcium 33: 489–495, 2003.[CrossRef][Web of Science][Medline]

96. Watanabe H, Vriens J, Prenen J, Droogmans G, Voets T, and Nilius B. Anandamide and arachidonic acid use epoxyeicosatrienoic acids to activate TRPV4 channels. Nature 424: 434–438, 2003.[CrossRef][Medline]

97. Watanabe H, Vriens J, Suh SH, Benham CD, Droogmans G, and Nilius B. Heat-evoked activation of TRPV4 channels in an HEK293 cell expression system and in native mouse aorta endothelial cells. J Biol Chem 277: 47044–47051, 2002.[Abstract/Free Full Text]

98. Wilson RI and Nicoll RA. Endocannabinoid signaling in the brain. Science 296: 678–682, 2002.[Abstract/Free Full Text]

99. Wissenbach U, Bodding M, Freichel M, and Flockerzi V. Trp12, a novel Trp related protein from kidney. FEBS Lett 485: 127–134, 2000.[CrossRef][Web of Science][Medline]

100. Xu H, Zhao H, Tian W, Yoshida K, Roullet JB, and Cohen DM. Regulation of a TRP channel by tyrosine phosphorylation: Src family kinase-dependent phosphorylation of TRPV4 on Y253 mediates its response to hypotonic stress. J Biol Chem 278: 11520–11527, 2003.[Abstract/Free Full Text]

101. Xu HX, Ramsey IS, Kotecha SA, Moran MM, Chong JA, Lawson D, Ge P, Lilly J, Silos-Santiago I, Xie Y, DiStefano PS, Curtis R, and Clapham DE. TRPV3 is a calcium-permeable temperature-sensitive cation channel. Nature 418: 181–186, 2002.[CrossRef][Medline]

102. Yuspa SH, Kilkenny AE, Steinert PM, and Roop DR. Expression of murine epidermal differentiation markers is tightly regulated by restricted extracellular calcium concentrations in vitro. J Cell Biol 109: 1207–1217, 1989.[Abstract/Free Full Text]

103. Zhou Y, Morais-Cabral JH, Kaufman A, and MacKinnon R. Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0 Å resolution. Nature 414: 43–48, 2001.[CrossRef][Medline]

104. Zygmunt PM, Julius I, Di Marzo I, and Hogestatt ED. Anandamide— the other side of the coin. Trends Pharmacol Sci 21: 43–44, 2000.[CrossRef][Medline]

105. Zygmunt PM, Petersson J, Andersson DA, Chuang H, Sorgard M, Di Marzo V, Julius D, and Hogestatt ED. Vanilloid receptors on sensory nerves mediate the vasodilator action of anandamide. Nature 400: 452–457, 1999.[CrossRef][Medline]




This article has been cited by other articles:


Home page
Hum Mol GenetHome page
G. Zhu, ICGN Investigators, A. Gulsvik, P. Bakke, S. Ghatta, W. Anderson, D. A. Lomas, E. K. Silverman, and S. G. Pillai
Association of TRPV4 gene polymorphisms with chronic obstructive pulmonary disease
Hum. Mol. Genet., June 1, 2009; 18(11): 2053 - 2062.
[Abstract] [Full Text] [PDF]


Home page
Mol. Pharmacol.Home page
J. Vriens, G. Appendino, and B. Nilius
Pharmacology of Vanilloid Transient Receptor Potential Cation Channels
Mol. Pharmacol., June 1, 2009; 75(6): 1262 - 1279.
[Abstract] [Full Text] [PDF]


Home page
Physiol. Rev.Home page
E. K. Hoffmann, I. H. Lambert, and S. F. Pedersen
Physiology of Cell Volume Regulation in Vertebrates
Physiol Rev, January 1, 2009; 89(1): 193 - 277.
[Abstract] [Full Text] [PDF]


Home page
Cardiovasc ResHome page
A. E. Loot, R. Popp, B. Fisslthaler, J. Vriens, B. Nilius, and I. Fleming
Role of cytochrome P450-dependent transient receptor potential V4 activation in flow-induced vasodilatation
Cardiovasc Res, December 1, 2008; 80(3): 445 - 452.
[Abstract] [Full Text] [PDF]


Home page
Nephrol Dial TransplantHome page
P. Lu, S. Boros, Q. Chang, R. J. Bindels, and J. G. Hoenderop
The {beta}-glucuronidase klotho exclusively activates the epithelial Ca2+ channels TRPV5 and TRPV6
Nephrol. Dial. Transplant., November 1, 2008; 23(11): 3397 - 3402.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
T. Karasawa, Q. Wang, Y. Fu, D. M. Cohen, and P. S. Steyger
TRPV4 enhances the cellular uptake of aminoglycoside antibiotics
J. Cell Sci., September 1, 2008; 121(17): 2871 - 2879.
[Abstract] [Full Text] [PDF]


Home page
JCBHome page
M. Kottgen, B. Buchholz, M. A. Garcia-Gonzalez, F. Kotsis, X. Fu, M. Doerken, C. Boehlke, D. Steffl, R. Tauber, T. Wegierski, et al.
TRPP2 and TRPV4 form a polymodal sensory channel complex
J. Cell Biol., August 11, 2008; 182(3): 437 - 447.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Respir. Cell Mol. Bio.Home page
M.-Y. Jian, J. A. King, A.-B. Al-Mehdi, W. Liedtke, and M. I. Townsley
High Vascular Pressure-Induced Lung Injury Requires P450 Epoxygenase-Dependent Activation of TRPV4
Am. J. Respir. Cell Mol. Biol., April 1, 2008; 38(4): 386 - 392.
[Abstract] [Full Text] [PDF]


Home page
J. Neurosci.Home page
V. Meseguer, Y. Karashima, K. Talavera, D. D'Hoedt, T. Donovan-Rodriguez, F. Viana, B. Nilius, and T. Voets
Transient Receptor Potential Channels in Sensory Neurons Are Targets of the Antimycotic Agent Clotrimazole
J. Neurosci., January 16, 2008; 28(3): 576 - 586.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Renal Physiol.Home page
L. Wu, X. Gao, R. C. Brown, S. Heller, and R. G. O'Neil
Dual role of the TRPV4 channel as a sensor of flow and osmolality in renal epithelial cells
Am J Physiol Renal Physiol, November 1, 2007; 293(5): F1699 - F1713.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Lung Cell. Mol. Physiol.Home page
K. Hamanaka, M.-Y. Jian, D. S. Weber, D. F. Alvarez, M. I. Townsley, A. B. Al-Mehdi, J. A. King, W. Liedtke, and J. C. Parker
TRPV4 initiates the acute calcium-dependent permeability increase during ventilator-induced lung injury in isolated mouse lungs
Am J Physiol Lung Cell Mol Physiol, October 1, 2007; 293(4): L923 - L932.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Regul. Integr. Comp. Physiol.Home page
A. Fredsted, H. Gissel, K. Madsen, and T. Clausen
Causes of excitation-induced muscle cell damage in isometric contractions: mechanical stress or calcium overload?
Am J Physiol Regulatory Integrative Comp Physiol, June 1, 2007; 292(6): R2249 - R2258.
[Abstract] [Full Text] [PDF]


Home page
Physiol. Rev.Home page
B. Nilius, G. Owsianik, T. Voets, and J. A. Peters
Transient Receptor Potential Cation Channels in Disease
Physiol Rev, January 1, 2007; 87(1): 165 - 217.
[Abstract] [Full Text] [PDF]


Home page
J. Physiol.Home page
R. C. Hardie
TRP channels and lipids: from Drosophila to mammalian physiology
J. Physiol., January 1, 2007; 578(1): 9 - 24.
[Abstract] [Full Text] [PDF]


Home page
Physiol. GenomicsHome page
S. Saito and R. Shingai
Evolution of thermoTRP ion channel homologs in vertebrates
Physiol Genomics, November 21, 2006; 27(3): 219 - 230.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Renal Physiol.Home page
C. E. Hills, R. Bland, D. C. Wheelans, J. Bennett, P. M. Ronco, and P. E. Squires
Glucose-evoked alterations in connexin43-mediated cell-to-cell communication in human collecting duct: a possible role in diabetic nephropathy
Am J Physiol Renal Physiol, November 1, 2006; 291(5): F1045 - F1051.
[Abstract] [Full Text] [PDF]


Home page
Circ. Res.Home page
F.-R. E. Curry and C. A. Glass
TRP Channels and the Regulation of Vascular Permeability: New Insights From the Lung Microvasculature
Circ. Res., October 27, 2006; 99(9): 915 - 917.
[Full Text] [PDF]


Home page
Circ. Res.Home page
D. F. Alvarez, J. A. King, D. Weber, E. Addison, W. Liedtke, and M. I. Townsley
Transient Receptor Potential Vanilloid 4-Mediated Disruption of the Alveolar Septal Barrier: A Novel Mechanism of Acute Lung Injury
Circ. Res., October 27, 2006; 99(9): 988 - 995.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Renal Physiol.Home page
G. Gamba
TRPV4: a new target for the hypertension-related kinases WNK1 and WNK4
Am J Physiol Renal Physiol, June 1, 2006; 290(6): F1303 - F1304.
[Full Text] [PDF]


Home page
J. Neurosci.Home page
N. Alessandri-Haber, O. A. Dina, E. K. Joseph, D. Reichling, and J. D. Levine
A transient receptor potential vanilloid 4-dependent mechanism of hyperalgesia is engaged by concerted action of inflammatory mediators.
J. Neurosci., April 5, 2006; 26(14): 3864 - 3874.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
V. K. Sidhaye, A. D. Guler, K. S. Schweitzer, F. D'Alessio, M. J. Caterina, and L. S. King
Transient receptor potential vanilloid 4 regulates aquaporin-5 abundance under hypotonic conditions
PNAS, March 21, 2006; 103(12): 4747 - 4752.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Cell Physiol.Home page
X. Liu, P. Zhu, and B. D. Freedman
Multiple eicosanoid-activated nonselective cation channels regulate B-lymphocyte adhesion to integrin ligands
Am J Physiol Cell Physiol, March 1, 2006; 290(3): C873 - C882.
[Abstract] [Full Text] [PDF]


Home page
JGPHome page
V. Lyall, H. Pasley, T.-H. T. Phan, S. Mummalaneni, G. L. Heck, A. K. Vinnikova, and J. A. DeSimone
Intracellular pH Modulates Taste Receptor Cell Volume and the Phasic Part of the Chorda Tympani Response to Acids
J. Gen. Physiol., December 27, 2005; 127(1): 15 - 34.
[Abstract] [Full Text] [PDF]


Home page
J. Neurophysiol.Home page
E. Guatteo, K. K. H. Chung, T. K. Bowala, G. Bernardi, N. B. Mercuri, and J. Lipski
Temperature Sensitivity of Dopaminergic Neurons of the Substantia Nigra Pars Compacta: Involvement of Transient Receptor Potential Channels
J Neurophysiol, November 1, 2005; 94(5): 3069 - 3080.
[Abstract] [Full Text] [PDF]


Home page
Circ. Res.Home page
X. Yao and C. J. Garland
Recent Developments in Vascular Endothelial Cell Transient Receptor Potential Channels
Circ. Res., October 28, 2005; 97(9): 853 - 863.
[Abstract] [Full Text] [PDF]


Home page
Circ. Res.Home page
J. Vriens, G. Owsianik, B. Fisslthaler, M. Suzuki, A. Janssens, T. Voets, C. Morisseau, B.D. Hammock, I. Fleming, R. Busse, et al.
Modulation of the Ca2 Permeable Cation Channel TRPV4 by Cytochrome P450 Epoxygenases in Vascular Endothelium
Circ. Res., October 28, 2005; 97(9): 908 - 915.
[Abstract] [Full Text] [PDF]


Home page
Sci SignalHome page
B. Nilius, T. Voets, and J. Peters
TRP Channels in Disease
Sci. Signal., August 2, 2005; 2005(295): re8 - re8.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Lung Cell. Mol. Physiol.Home page
Q. Gu, R.-L. Lin, H.-Z. Hu, M. X. Zhu, and L.-Y. Lee
2-Aminoethoxydiphenyl borate stimulates pulmonary C neurons via the activation of TRPV channels
Am J Physiol Lung Cell Mol Physiol, May 1, 2005; 288(5): L932 - L941.
[Abstract] [Full Text] [PDF]


Home page
J. Pharmacol. Exp. Ther.Home page
G. Appendino, L. De Petrocellis, M. Trevisani, A. Minassi, N. Daddario, A. S. Moriello, D. Gazzieri, A. Ligresti, B. Campi, G. Fontana, et al.
Development of the First Ultra-Potent "Capsaicinoid" Agonist at Transient Receptor Potential Vanilloid Type 1 (TRPV1) Channels and Its Therapeutic Potential
J. Pharmacol. Exp. Ther., February 1, 2005; 312(2): 561 - 570.
[Abstract] [Full Text] [PDF]


Home page
Physiol. Rev.Home page
J. G. J. Hoenderop, B. Nilius, and R. J. M. Bindels
Calcium Absorption Across Epithelia
Physiol Rev, January 1, 2005; 85(1): 373 - 422.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
Q.-H. Liu, X. Liu, Z. Wen, B. Hondowicz, L. King, J. Monroe, and B. D. Freedman
Distinct Calcium Channels Regulate Responses of Primary B Lymphocytes to B Cell Receptor Engagement and Mechanical Stimuli
J. Immunol., January 1, 2005; 174(1): 68 - 79.
[Abstract] [Full Text] [PDF]


Home page
J. Neurosci.Home page
Z. Gong, W. Son, Y. Doo Chung, J. Kim, D. W. Shin, C. A. McClung, Y. Lee, H. W. Lee, D.-J. Chang, B.-K. Kaang, et al.
Two Interdependent TRPV Channel Subunits, Inactive and Nanchung, Mediate Hearing in Drosophila
J. Neurosci., October 13, 2004; 24(41): 9059 - 9066.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Lung Cell. Mol. Physiol.Home page
Y. Jia, X. Wang, L. Varty, C. A. Rizzo, R. Yang, C. C. Correll, P. T. Phelps, R. W. Egan, and J. A. Hey
Functional TRPV4 channels are expressed in human airway smooth muscle cells
Am J Physiol Lung Cell Mol Physiol, August 1, 2004; 287(2): L272 - L278.
[Abstract] [Full Text] [PDF]


Home page
J. Neurosci.Home page
M.-K. Chung, H. Lee, A. Mizuno, M. Suzuki, and M. J. Caterina
2-Aminoethoxydiphenyl Borate Activates and Sensitizes the Heat-Gated Ion Channel TRPV3
J. Neurosci., June 2, 2004; 24(22): 5177 - 5182.
[Abstract] [Full Text] [PDF]


Home page
J. Neurosci.Home page
N. Alessandri-Haber, O. A. Dina, J. J. Yeh, C. A. Parada, D. B. Reichling, and J. D. Levine
Transient Receptor Potential Vanilloid 4 Is Essential in Chemotherapy-Induced Neuropathic Pain in the Rat
J. Neurosci., May 5, 2004; 24(18): 4444 - 4452.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Web of Science (95)
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Nilius, B.
Right arrow Articles by Voets, T.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Nilius, B.
Right arrow Articles by Voets, T.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Visit Other APS Journals Online
Copyright © 2004 by the American Physiological Society.