|
|
||||||||
Department of Obstetrics and Gynecology, Osaka University Faculty of Medicine, Osaka 565-0871; and Department of Microbiology, Mie University School of Medicine, Tsu, Japan
| |
ABSTRACT |
|---|
|
|
|---|
The neutral amino acid transport system L is a sodium-independent transport system in human placenta and choriocarcinoma cells. Recently, it was found that the heterodimer composed of hLAT1 (a light-chain protein) and 4F2 heavy chain (4F2hc), a type II transmembrane glycoprotein, is responsible for system L amino acid transport. We found that the mRNAs of 4F2hc and hLAT1 were expressed in the human placenta and a human choriocarcinoma cell line. The levels of the 4F2hc and hLAT1 proteins in the human placenta increased at full term compared with those at midtrimester. Immunohistochemical data showed that these proteins were localized mainly in the placental apical membrane. Data from leucine uptake experiments, Northern blot analysis, and immunoblot analysis showed that this transport system was partially regulated by protein kinase C and calcium ionophore in the human choriocarcinoma cell line. Our results suggest that the heterodimer of 4F2hc and hLAT1 may play an important role in placental amino acid transport system L.
amino acid transport system L; protein kinase C; calcium ionophore
| |
INTRODUCTION |
|---|
|
|
|---|
FACILITATED DIFFUSION and active transport are responsible for transport of substances such as glucose and amino acids, respectively. Glucose is transported by sodium-independent facilitated diffusion along a concentration gradient (4). The mechanism for placental glucose transport depends on the cellular membrane carrier proteins facilitative glucose transporters 1 and 3 (GLUT-1 and -3), which have been the subject of several reports (2, 5, 36, 41). On the other hand, active placental amino acid transport is thought to be mediated by specific carrier proteins, which have not been fully characterized.
On the basis of the nomenclature developed originally by Christensen et al. (10), amino acid transport systems such as L, y+L, A, and others have been identified in the placental syncytiotrophoblasts by means of a filtration method employing membrane vesicles (15, 17). Among these systems, amino acid transport system L in the human placenta and human choriocarcinoma cells is a sodium-independent transport system that is noted for its preferential affinity for hydrophobic neutral amino acids, including branched-chain and aromatic amino acids (17, 34). However, only a few studies of the regulation of the activity of amino acid transport system L have been reported (7, 34). Measurement of the uptake of the radiolabeled amino acids into cells revealed that system L transport activity is affected by protein kinase C and extracellular pH in the JAR human placental choriocarcinoma cell line (7, 34). Recently reported evidence also indicates that growth factors such as insulin, insulin-like growth factor I, and epidermal growth factor regulate other systems of placental amino acid transport (6, 19). However, more detailed studies involving different cell types, protein kinases, growth factors, and other effectors are needed to understand the regulation of the activities of system L and other amino acid transport systems.
The 4F2 (CD98) cell surface antigen is a 120-kDa disulfide-linked heterodimer composed of an ~80-kDa heavy chain and an ~40-kDa light chain (13, 14). The 4F2 antigen was originally identified as a lymphocyte activation antigen (13, 14), but its function has not been clarified. Recently, various members of a novel family of glycoprotein-associated amino acid transporters have been identified and shown to play an important role in cellular uptake and/or basolateral extrusion of basic and neutral amino acids. These permease-related proteins contain 12 putative transmembrane domains and require heterodimerization with a type II transmembrane heavy-chain protein such as 4F2hc to express their function as transporters. LAT1 (18, 23, 24, 26), y+LAT1 (31, 42), y+LAT2 (31, 42), xCT (38), and LAT2 (32, 40) have been shown to be linked with 4F2hc. The heterodimer composed of LAT1 and 4F2hc is known to be responsible for sodium-independent neutral amino acid transport (L-type transport) (18, 23, 24, 26). LAT2 also mediates system L transport with 4F2hc; however, LAT2 transports large and small neutral amino acids with lower affinity than LAT1 (32, 40). Other proteins such as y+LAT1 and y+LAT2 are associated with y+L-type transport, which transfers basic amino acids in a sodium-independent manner and neutral amino acids in a sodium-dependent manner (31, 42), while the xCT-4F2hc heterodimer transports cystine/glutamate (38). Progress in the molecular biological analysis of amino acid transport systems has thus enabled us to characterize the expression and regulation of the system L transport components hLAT1 and 4F2hc in human placenta and choriocarcinoma cells.
In this study, we examined whether 4F2hc and hLAT1 mRNAs are expressed in the human placenta and a human choriocarcinoma cell line. Next, we studied the gestation-dependent expression and localization of 4F2hc and hLAT1 in the human placenta. Finally, we examined the regulation of system L amino acid transport by protein kinase C and a calcium ionophore in the choriocarcinoma cell line.
| |
MATERIALS AND METHODS |
|---|
|
|
|---|
Chemicals.
4
-Phorbol 12-myristate 13-acetate (PMA), A-23187 (calcium
ionophore), EDTA, aprotinin, leupeptin, phenylmethylsulfonyl fluoride, and 2-amino-2-norbornane-carboxylic acid (BCH) were obtained from Sigma
(St. Louis, MO). L-[4,5-3H]leucine (69.0 Ci/mmol) and a multiprime DNA labeling kit were purchased from Amersham
(Arlington Heights, IL). [
-32P]ATP (3,000 Ci/mmol) was
purchased from ICN Biomedicals (Irvine, CA).
Cell culture. BeWo cells, human mononuclear cytotrophoblast-like choriocarcinoma cells, were obtained from the Health Science Research Resources Bank (Osaka, Japan). Cells were maintained in culture medium (Ham's F-12K with 0.12% NaHCO3, pH 7.4, 50 mg/l streptomycin, and 50 kU/l penicillin G) containing 15% fetal bovine serum in an atmosphere of 95% air-5% CO2 at 37°C. Confluent cells were treated with 0.02% EDTA and 0.25% trypsin, and the trypsinized cells were transferred to new flasks at a density of 1 × 104/cm2. The trypsinized cells were plated in 24-well disposable Falcon dishes at a density of 1.0 × 105 cells/well and allowed to grow as a monolayer until confluency.
Measurement of leucine uptake. Uptake of L-[4,5-3H]leucine was measured in BeWo cells plated in 24-well plates as described previously (6 wells per group) (37). The medium was removed from the monolayer cultures, and each well was washed rapidly twice with a buffer containing 25 mmol/l HEPES, pH 7.5, 140 mmol/l NaCl (or 140 mmol/l choline chloride instead of NaCl), 5.4 mmol/l KCl, 1.8 mmol/l CaCl2, and 0.8 mmol/l MgSO4 (uptake buffer). After the cells had been washed, leucine uptake was measured by addition of 1 ml of uptake buffer containing 10 nmol/l radiolabeled leucine. BCH (1 mmol/l) was used for the inhibition of L system-mediated uptake. After 5 min of incubation, the radioactive buffer was removed, and each well was rapidly washed twice with the uptake buffer. The cells were solubilized in 1 ml of 0.03% sodium dodecyl sulfate (SDS), the lysate was transferred to a scintillation vial, and the radioactivity of the contents was measured with a liquid scintillation counter.
Leucine uptake was measured in six wells per group for each experiment on BeWo cells plated in 24-well plates. Each experiment was repeated at least twice with similar results, and representative results are shown.Treatment of BeWo cells with phorbol ester and calcium ionophore. Stock solutions of phorbol ester and calcium ionophore were prepared in dimethyl sulfoxide (DMSO). These solutions were appropriately diluted with the culture medium and used for treatment of cells that had been pretreated with 1% fetal bovine serum for 18 h. The final concentration of DMSO during the treatment was <0.02%. For each experiment, control cells were treated with the respective concentration of DMSO. After incubation for the desired time, the medium was aspirated and cells were washed twice with the uptake buffer for the measurement of uptake or with phosphate-buffered saline for Northern blot and immunoblot analysis.
Northern blot analysis.
Northern blot analysis was performed as described previously (8,
9, 35). After total RNA was isolated, polyadenylated RNA was
prepared using the PolyATtract mRNA Isolation System (Promega, Madison,
WI). Poly(A)+ RNA samples (2.0 µg/lane) were denatured,
electrophoresed on 1.2% agarose-formaldehyde gels, and transferred to
nylon membrane filters (Zeta-Probe, Bio-Rad, Richmond, CA) in 20× SSC
(333 mmol/l NaCl and 333 mmol/l sodium citrate, pH 7.0), and the
filters were baked at 80°C for 2 h. The filters were then
prehybridized for 1 h at 43°C in hybridization buffer (50%
formamide, 170 mmol/l Na2HPO4, 60 mmol/l
NaH2PO4, 250 mmol/l NaCl, 1 mmol/l EDTA, and 7% SDS) and hybridized to the radiolabeled complementary 4F2hc or E16
(22) DNA (cDNA) probe (2 × 106 cpm/ml)
for 18 h at 43°C. E16 is a truncated form of human LAT1 protein
(33), and E16 cDNA can be used in Northern blot analysis for the detection of hLAT1 mRNA. Filters were washed for 10 min twice
in 2× SSC-0.1% SDS at room temperature and then for 15 min in 1×
SSC-0.1% SDS at 65°C and finally autoradiographed for 2 days at
80°C. The same blots were reprobed with
-actin cDNA as a control
to correct for the integrity and amount of RNA loaded. The band
intensities were analyzed with a densitometer (Imaging Research, St.
Catharine, ON, Canada), and the amounts of 4F2hc and hLAT1 mRNA were
divided by the amounts of
-actin mRNA in the same lanes.
Preparation of membrane fractions.
Full-term placentas (37-41 wk of pregnancy) from uncomplicated
pregnancies were obtained after cesarean section, and midtrimester placentas (12-21 wk) were obtained after artificial abortions with
the informed consent of each patient. After removal of the cord,
amniochorion, and decidual layer, the tissue was cut into small pieces
and washed with 154 mmol/l NaCl to remove blood. The tissue was
homogenized in 10 volumes of sucrose buffer containing 10 mmol/l
Tris · HCl (pH 7.4), 250 mmol/l sucrose, 5 mmol/l EDTA, 1 mmol/l phenylmethylsulfonyl fluoride, 20 mg/l leupeptin, and 20 mg/l
aprotinin with a Dounce homogenizer. The homogenized tissue was
centrifuged at 2,600 rpm for 10 min at 4°C and the supernatant at
45,000 rpm for 1 h at 4°C. The pellets were resuspended in resuspension buffer containing 20 mmol/l Tris · HCl (pH 7.4), 1 mmol/l EDTA, 100 mmol/l NaCl, and 4 mmol/l MgCl2
(29) and stored at
20°C. The concentration of protein
was determined using a Bradford protein assay kit (Bio-Rad) with BSA as
the standard.
Purification of 4F2 complex protein, isolation of hybridoma cell line, and characterization of monoclonal antibody recognizing hLAT1. IMAA (GenBank AB040413, BAB20039) is a putative protein that consists of 180 amino acid residues and whose mRNA is expressed in HeLa S3 cells. Homology search analysis using advanced BLAST indicated that the amino acid sequence of IMAA has 92.2% homology with that of the NH2 terminus (180 residues) of hLAT1. It is assumed that IMAA corresponds to the three transmembrane domains of hLAT1 and that it may form an intermolecular disulfide bond with 4F2hc at Cys164. A cDNA expression vector that expresses the NH2-terminal region of IMAA (68 amino acid residues: NH2-MAGAGPKRRALAAPVAEEKEEAREKIMA- AKRADGAAPAGEGEGVTLQGNITLLKGVAVIVVAIMGSGI) was transformed into Escherichia coli strain BL21 (DE3) pLysS. After cultivation, the bacteria were harvested, and an inclusion body preparation was made. The bacterially expressed NH2-terminal amino acid fragment of IMAA in this crude inclusion body preparation was further purified by SDS-PAGE before injection into a BALB/c mouse. The purified IMAA fragment was mixed with 100 µg of lipopolysaccharide and injected subcutaneously into a BALB/c mouse. The mouse was boosted twice by such injections, and hybridoma cells were produced as described previously (45). Hybridoma cells of interest were further screened by immunoblot analysis (44) in which the plasma membrane fraction and purified 4F2 complex were used. Plasma membranes were prepared from HeLa S3 cells according to the method described by Maeda et al. (22). The plasma membranes were solubilized as described previously (30) and subjected to gel filtration chromatography to obtain the 4F2hc complex. The fractions were screened for 4F2hc antigen by dot-blot immunostaining using monoclonal antibody directed against 4F2hc (6-1-13) (43), and the antigen-positive fractions were applied to an immunoaffinity column (coupled with monoclonal antibody 6-1-13). The bound 4F2 complex purified from HeLa S3 cells, which should contain the heterodimer of 4F2hc and hLAT1, was separated by SDS-PAGE using a Tris-glycine buffer system under reducing conditions (39) and blotted onto a nitrocellulose membrane. The membrane was treated successively with monoclonal antibody (181C) or the monoclonal antibody against human parainfluenza virus type 2F protein as a negative control (117-1A) (44), biotinylated horse immunoglobulin to mouse IgG (heavy and light chains; Vector Laboratories, Burlingame, CA), and avidin-biotin-peroxidase complex (Vector Laboratories). The immunostained bands were visualized as described previously (44). This monoclonal antibody (181C) detected a 40-kDa protein in a 4F2 complex consisting of 4F2hc and hLAT1, and similar results of immunoblot analysis were obtained for the membrane fraction of HeLa S3 cells (data not shown). For competition studies, we used a synthetic peptide consisting of the 36-46th amino acids from the NH2 terminus of IMAA (APAGEGEGVTL) as the blocking peptide for 181C.
Immunoblot analysis. The proteins were denatured with an equal amount of buffer containing 200 mmol/l dithiothreitol, 20% glycerol, 0.04% bromphenol blue, 10% SDS, and 120 mmol/l Tris · HCl (pH 6.8) and incubated for 5 min at 100°C. Denatured samples (50 µg/lane) were subjected to 7.5% SDS-PAGE (21) and transferred to nitrocellulose filters (46) (Bio-Rad).
The membranes were presoaked in 5% nonfat dry milk in 10 mmol/l Tris-buffered saline (TBS) for 1.5 h at room temperature. They were then incubated with anti-4F2hc goat polyclonal antibody (1:1,600; Research Diagnostics, Flanders, NJ) in 5% nonfat dry milk in TBS-T (0.1% Tween 20 in TBS), with the anti-4F2hc antibody that had been preincubated with the blocking peptide (Research Diagnostics), with the undiluted culture fluid containing the monoclonal antibody (181C), or with the monoclonal antibody (181C) that had been preincubated with the synthetic blocking peptide (APAGEGEGVTL) for 181C for 2 h at room temperature. The membranes were washed three times with TBS-T and then incubated with peroxidase-labeled rabbit anti-goat IgG (1: 10,000; Kirkegaard and Perry Laboratories, Gaithersburg, MD) or with peroxidase-labeled goat anti-mouse IgG (1: 15,000; Promega) for 30 min at room temperature and developed for the detection of the specific protein using enhanced chemiluminescence reagents (Amersham). The band intensities were analyzed as described above.Immunohistochemistry. Representative blocks of formalin-fixed, paraffin-embedded placental tissue were cut to 4-µm-thick sections and processed by the standard avidin-biotin peroxidase method. Briefly, the sections were dewaxed in xylene and rinsed in ethanol and a graded series of ethanol in water, and the endogenous peroxidase activity was blocked with 3% hydrogen peroxide. Samples were incubated with 1% bovine serum and then with the primary antibody [the polyclonal antibody to 4F2hc, the monoclonal antibody to cytokeratin AE1/AE3 (DAKO, Carpinteria, CA) at 1 mg/l, or the culture fluid containing the monoclonal antibody (181C) for detection of hLAT1] for 2 h at room temperature. After the samples were rinsed, biotinylated secondary antibody (Santa Cruz Biotechnology, Santa Cruz, CA) and horseradish peroxidase-conjugated streptavidin (Nichirei, Tokyo, Japan) were applied to the sections according to the manufacturer's instructions. Peroxidase activity was visualized by means of a 3-min application of diaminobenzidine chromogen containing 0.05% hydrogen peroxide. The sections were then counterstained with hematoxylin, dehydrated, cleared, and mounted. Control sections were also treated with the anti-4F2hc antibody preincubated with a blocking peptide or with 181C preincubated with a blocking peptide.
Statistical methods. Values are means ± SE and were statistically analyzed by analysis of variance followed by the unpaired t-test. Statistical significance was accepted at P < 0.05.
| |
RESULTS |
|---|
|
|
|---|
It has been shown that hLAT1, when combined as a heterodimer with
4F2hc, is capable of amino acid transport activity characteristic of
system L. Northern blot analysis demonstrated that the mRNAs encoding
these proteins were expressed in the human placenta and a BeWo human
choriocarcinoma cell line (Fig. 1).
|
To examine the presence of 4F2hc and hLAT1 proteins, we performed
immunoblot analysis of the 4F2hc and hLAT1 proteins in human placenta
and the BeWo cell line. Figure
2A shows that these proteins were detected in the BeWo cell line (lane 1) and human
placenta (lane 3). When the blots were incubated with the
antibody to 4F2hc that had been treated with a blocking peptide
(lanes 2 and 4, top) or with 181C that had been
treated with a blocking peptide (lanes 2 and 4, bottom) as negative controls, these protein signals were not
detected. Next, we used immunoblot analysis of the 4F2hc and hLAT1
proteins in the human placenta to detect gestational changes in these
proteins. Densitometric scanning of the immunoblots showed that the
level of 4F2hc protein in the full-term placenta (2.32 ± 0.51 arbitrary units) was significantly (P < 0.05) higher than that in the midtrimester placenta (0.94 ± 0.40 arbitrary units). Similar results were observed for the levels of hLAT1 protein
in the midtrimester (0.48 ± 0.26 arbitrary units) and the
full-term (0.84 ± 0.13 arbitrary units) placenta (Fig.
2B).
|
Because it is known that the localization of the amino acid transport
systems is polarized in the human placenta, we used immunohistochemistry to detect 4F2hc and hLAT1 and found that these
proteins were localized mainly in the placental apical membrane (Fig.
3, A and B). We
also detected endothelial staining (Fig. 3, C and
E), which seemed weaker than that in the apical membrane. When the sections were treated with anti-4F2hc antibody after preincubation with the blocking peptide, the immunostaining was not
detected (Fig. 3D). When control sections were treated with 181C preincubated with the blocking peptide, no noticeable staining was
observed (Fig. 3F). When the sections were treated with
antibody against cytokeratin, staining was observed not in the membrane but in the cytosol (data not shown).
|
It has been reported that treatment with PMA stimulates the system L
transport activity in a human choriocarcinoma cell line (JAR)
(34) and that combined treatment with PMA and calcium ionophore stimulates the expression of hLAT1 mRNA in lymphoid cells
(12). We therefore conducted [3H]leucine
uptake experiments on BeWo cells after PMA and calcium ionophore
treatment to determine whether the activity of system L was regulated
by these effectors in these cells. The uptake of leucine into these
cells was linear for
10 min (data not shown), and therefore, we
measured the [3H]leucine uptake into the cells for 5 min.
Although treatment with PMA (1 µmol/l) or calcium ionophore (1 µmol/l) alone did not stimulate leucine uptake, combined treatment
with PMA and calcium ionophore for 3 h significantly
(P < 0.01) stimulated it (Fig.
4A). Stimulation was also
observed after 6 h, but not after 1 h, of treatment. Although
the uptake of leucine was decreased 18% (Fig. 4B) when the
uptake buffer was changed to choline chloride instead of sodium
chloride, stimulation of leucine uptake by PMA and calcium ionophore
was similar in both buffers. To determine the substrate specificity of
the transport system responsible for leucine uptake in these cells, we
studied the effects of unlabeled BCH, a model substrate for the L
system, on the uptake of leucine. BCH (1 mmol/l) caused 90% inhibition
of leucine uptake (Fig. 4B), and no stimulation of leucine
uptake by PMA and calcium ionophore was observed in the presence of
BCH.
|
To determine whether the increase in leucine uptake in the BeWo cells
was due to increases in 4F2hc and/or hLAT1 expression, we first used
Northern blot analysis to analyze the changes in the steady-state
levels of 4F2hc and hLAT1 mRNAs. Combined treatment with PMA and
calcium ionophore significantly (P < 0.05) increased the levels of 4F2hc and hLAT1 mRNAs, while the amount of
-actin mRNA
did not change significantly after the treatment (normalized band
intensities in arbitrary units: 0.89 ± 0.33 for 4F2hc control, 6.07 ± 1.56 after PMA and calcium ionophore treatment, 0.55 ± 0.22 for hLAT1 control, and 1.69 ± 0.51 after PMA and calcium ionophore treatment; Fig. 5A),
which was consistent with the results for leucine uptake shown in
Fig. 4. Next, we used immunoblot analysis of the 4F2hc and hLAT1
proteins in the BeWo cells to analyze the changes of these proteins.
Densitometric scanning showed that combined treatment with PMA and
calcium ionophore significantly (P < 0.01)
increased the levels of 4F2hc and hLAT1 proteins (Fig. 5B).
|
| |
DISCUSSION |
|---|
|
|
|---|
Heterodimers of 4F2hc and light chains such as LAT1, y+LAT1, y+LAT2, xCT, and LAT2 have recently been shown to be responsible for several systems of amino acid transport. The heterodimer of 4F2hc and LAT1 in particular is thought to function as a system L amino acid transporter that can transfer neutral and aromatic amino acids in a sodium-independent manner. In previous reports, the expression of 4F2hc, LAT1 (18), and LAT2 (32, 40) mRNAs in human placenta was shown. The present study demonstrated the expression of 4F2hc and hLAT1 mRNA in the human placenta and a human choriocarcinoma (BeWo) cell line by means of Northern blot analysis with findings similar to those reported previously (20, 33).
The 4F2hc and hLAT1 proteins were also detected in the human placental membrane by immunoblot analysis. Together, these results suggest that the 4F2hc-hLAT1 heterodimer works as a system L amino acid transporter in the placenta in a manner similar to that in other organs. Although apical and basal membranes were included in our experiment, the levels of 4F2hc and hLAT1 proteins increased at full term compared with those at midtrimester (Fig. 2B), which agrees with the results of a previous study of rat placenta (27). It seems likely that the increased levels of placental 4F2hc and hLAT1 proteins in the L system play an important role in amino acid transport from mother to fetus during pregnancy.
In the immunoblot analysis of hLAT1 protein, we detected a protein band of ~50 kDa in placenta and one of ~40 kDa in BeWo cells. Although we do not now why the apparent molecular size of the placental hLAT1 protein in our immunoblot analysis was larger than expected, the discrepancy may be the result of differences in posttranscriptional regulation of hLAT1 mRNA or posttranscriptional modification of hLAT1 protein, perhaps related to the glycoprotein characteristics of hLAT1 protein (33). In studies using an anti-GLUT-1 antibody, we made a similar observation that the molecular size of GLUT-1 protein detected by immunoblot analysis differs between human placental tissue [60 kDa (minor band) and 49 kDa (major band)] (36) and BeWo cells (broad 46 kDa) (28).
Next we examined whether any significant changes occur in the levels of 4F2hc or hLAT1 mRNA in human placenta between midtrimester and full term, but none were detected (data not shown). This discrepancy between the results of immunoblot and Northern blot analysis may be due to possible posttranscriptional regulation of the 4F2hc and hLAT1 mRNAs or modification of the 4F2hc and hLAT1 proteins.
In the human placenta, the amino acid transport systems are thought to be predominantly located in specific membranes (15-17, 34). Therefore, apical and basal membranes from the human placenta were analyzed separately to examine which membrane contains which specific amino acid transport system(s) on the basis of findings that apical and basal membranes possess system L (15-17) and y+L (3, 11) amino acid transport. It was not known whether the apical or basal membrane expresses heterodimers composed of the 4F2hc protein in combination with hLAT1, hLAT2, or y+LAT to form the transporter for the L or y+L system, respectively. Our immunohistochemical data revealed that specific staining for 4F2hc and hLAT1, which are responsible for system L amino acid transport, was localized in the apical, but not the basal, membrane of trophoblasts. It was reported previously (3) that 4F2hc proteins were not detected in the basal membrane, despite functional evidence for the presence of system y+L. Our data about 4F2hc protein localization are consistent with those reported by Ayuk et al. (3).
To our knowledge, only a few studies of the regulation of amino acid transport system L have been published. In one previous study, it was shown that treatment of JAR human choriocarcinoma cells with PMA resulted in a significant stimulation of system L as measured in terms of radiolabeled amino acid uptake into the cells (34). Another study demonstrated that E16 cDNA, a truncated form of hLAT1 cDNA, could be cloned by the subtraction hybridization method after stimulation of the lymphoid cells with PMA and calcium ionophore (12). However, there are no reports on how the system L amino acid transporter is regulated with respect to 4F2hc and hLAT1 in the human placenta. We therefore examined the effects of PMA and calcium ionophore treatment on the uptake of leucine (a representative amino acid transported by system L) and the expression of 4F2hc and hLAT1 mRNAs and proteins in a human choriocarcinoma (BeWo) cell line. We chose BeWo cells, which have the potential for differentiation, because it has been shown that the cells undergo fusion and morphological differentiation after cAMP treatment similar to the fusion of cytotrophoblasts to form syncytiotrophoblasts after cAMP treatment. Combined treatment with PMA and calcium ionophore resulted in significantly increased uptake of leucine in the BeWo cells. We also demonstrated that incubation of BeWo cells with PMA and calcium ionophore induced a significant increase in 4F2hc and hLAT1 mRNAs and proteins. These data are not consistent with previously reported data which indicated that the expression of 4F2hc, not of hLAT1, may be rate limiting for system L amino acid transport (20). This discrepancy may result from differences between the cell line and tissue. The published study used dissected pieces of chorionic villi from full-term placenta. Additionally, E16 mRNA (a truncated form of hLAT1 mRNA) was increased in lymphoid cells after the stimulation with PMA and calcium ionophore (11), which was similar to our findings. Figure 4B shows that BCH (1 mmol/l), a model substrate for the L system, did not completely inhibit the uptake of leucine. This suggests that uptake of leucine into the cells is also mediated by other transport systems. Moreover, we showed previously that the degree of the increase of GLUT-1 mRNA was greater than that of 2-deoxyglucose uptake in BeWo cells after cAMP treatment (28). The discrepancy between the changes in the amino acid uptake level and the mRNA level for system L may arise from similar causes. These results suggest that PMA and calcium ionophore may play an important role in the regulation of leucine uptake mediated by system L and in 4F2hc and hLAT1 mRNA and protein expression in BeWo cells. The molecular mechanisms that are responsible for the specific stimulation of leucine uptake and 4F2hc and hLAT1 expression by PMA and calcium ionophore in BeWo cells are not fully understood. PMA is a phorbol ester that is capable of activating protein kinase C, and PMA has been shown to have a stimulating effect on human chorionic gonadotropin secretion in choriocarcinoma cells (1). It has also been suggested that calcium ionophores, which increase intracellular calcium, enhance the potency of phorbol ester for activating protein kinase C in human leukemia cells (25) and in Madin-Darby canine kidney cells (47). We showed that PMA and intracellular calcium synergistically stimulate the expression of 4F2hc and hLAT1 mRNAs and proteins. These events may be involved in regulating the levels of leucine uptake after PMA and calcium ionophore treatment.
Our results suggest that the levels of 4F2hc and hLAT1 may regulate the system L amino acid transport in the human placenta. Further investigations are needed to clarify the molecular mechanisms responsible for the expression and regulation of the 4F2hc-LAT1 heterodimer and other amino acid transporters in the human placenta.
| |
FOOTNOTES |
|---|
Address for reprint requests and other correspondence: M. Sakata, Dept. of Obstetrics and Gynecology, Osaka University Faculty of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871, Japan (E-mail: msakata{at}gyne.med.osaka-u.ac.jp).
The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
Received 18 December 2000; accepted in final form 4 September 2001.
| |
REFERENCES |
|---|
|
|
|---|
1.
Andersen, B,
Milsted A,
Kennedy G,
and
Nilson JH.
Cyclic AMP and phorbol esters interact synergistically to regulate expression of the chorionic gonadotropin genes.
J Biol Chem
263:
15578-15583,
1988
2.
Asano, T,
Shibasaki Y,
Kasuga M,
Kanazawa Y,
Takaku F,
Akanuma Y,
and
Oka Y.
Cloning of a rabbit brain glucose transporter cDNA and alteration of glucose transporter mRNA during tissue development.
Biochem Biophys Res Commun
154:
1204-1211,
1988[ISI][Medline].
3.
Ayuk, PT,
Sibley CP,
Donnai P,
D'Souza S,
and
Glazier JD.
Development and polarization of cationic amino acid transporters and regulators in the human placenta.
Am J Physiol Cell Physiol
278:
C1162-C1170,
2000
4.
Baly, DL,
and
Horuk R.
The biology and biochemistry of the glucose transporter.
Biochim Biophys Acta
947:
571-590,
1988[Medline].
5.
Bell, GI,
Kayano T,
Buse JB,
Burant CF,
Takeda J,
Lin D,
Fukumoto H,
and
Seino S.
Molecular biology of mammalian glucose transporters.
Diabetes Care
13:
198-208,
1990[Abstract].
6.
Bloxam, DL,
Bax BE,
and
Bax CMR
Epidermal growth factor and insulin-like growth factor I differently influence the directional accumulation and transfer of 2-aminoisobutyrate (AIB) by human placental trophoblast in two-sided culture.
Biochem Biophys Res Commun
199:
922-929,
1994[ISI][Medline].
7.
Brandsch, M,
Leibach FH,
Mahesh VB,
and
Ganapathy V.
Calmodulin-dependent modulation of pH sensitivity of the amino acid transport system L in human placental choriocarcinoma cells.
Biochim Biophys Acta
1192:
177-184,
1994[Medline].
8.
Chen, CF,
Kurachi H,
Fujita Y,
Terakawa N,
Miyake A,
and
Tanizawa O.
Changes in epidermal growth factor receptor and its messenger ribonucleic acid levels in human placenta and isolated trophoblast cells during pregnancy.
J Clin Endocrinol Metab
67:
1171-1177,
1988[Abstract].
9.
Chomczynski, P,
and
Sacchi N.
Single-step method of RNA isolation by acid guanidinium thiocyanate-phenol-chloroform extraction.
Anal Biochem
162:
156-159,
1987[ISI][Medline].
10.
Christensen, HN,
Albritton LM,
Kakuda DK,
and
MacLeod CL.
Gene-product designations for amino acid transporters.
J Exp Biol
196:
51-57,
1994
11.
Furesz, TC,
and
Smith CH.
Identification of two leucine-sensitive lysine transport activities in human placental basal membrane.
Placenta
18:
649-655,
1997[ISI][Medline].
12.
Gaugitsch, HW,
Prieschl EE,
Kalthoff F,
Huber NE,
and
Baumruker T.
A novel transiently expressed, integral membrane protein linked to cell activation. Molecular cloning via the rapid degradation signal AUUUA.
J Biol Chem
267:
11267-11273,
1992
13.
Haynes, BF,
Hemler ME,
Mann DL,
Eisenbarth GS,
Shelhamer J,
Mostowski HS,
Thomas CA,
Strominger JL,
and
Fauci AS.
Characterization of a monoclonal antibody.
J Biol Chem
273:
23629-23632,
1998
14.
Hemler, ME,
and
Strominger JL.
Characterization of antigen recognized by the monoclonal antibody (4F2): different molecular forms on human T and B lymphoblastoid cell lines.
J Immunol
129:
623-628,
1982[Abstract].
15.
Hoeltzli, SD,
and
Smith CH.
Alanine transport systems in isolated basal plasma membrane of human placenta.
Am J Physiol Cell Physiol
256:
C630-C637,
1989
16.
Illsley, NP,
Wang Z-Q,
Gray A,
Sellers MC,
and
Jacobs MM.
Simultaneous preparation of paired, syncytial, microvillous and basal membranes from human placenta.
Biochim Biophys Acta
1029:
218-226,
1990[Medline].
17.
Johnson, LW,
and
Smith CH.
Neutral amino acid transport systems of microvillous membrane of human placenta.
Am J Physiol Cell Physiol
254:
C773-C780,
1988
18.
Kanai, Y,
Segawa H,
Miyamoto K,
Uchino H,
Takeda E,
and
Endou H.
Expression cloning and characterization of a transporter for large neutral amino acids activated by the heavy chain of 4F2 antigen (CD98).
J Biol Chem
273:
23629-23632,
1998.
19.
Karl, PI,
Alpy KL,
and
Fisher SE.
Amino acid transport by the cultured human placental trophoblast: effect of insulin on AIB transport.
Am J Physiol Cell Physiol
262:
C834-C839,
1992
20.
Kudo, Y,
and
Boyd CAR
Heterodimeric amino acid transporters: expression of heavy but not light chains of CD98 correlates with induction of amino acid transport systems in human placental trophoblast.
J Physiol (Lond)
523:
13-18,
2000
21.
Laemmli, UK.
Cleavage of structural proteins during the assembly of the head of bacteriophage T4.
Nature
277:
680-685,
1970.
22.
Maeda, T,
Balakrishnan K,
and
Mehdi O.
A simple and rapid method for the preparation of plasma membranes.
Biochim Biophys Acta
731:
115-120,
1983[Medline].
23.
Mannion, BA,
Kolesnikova TV,
Lin SH,
Wang S,
Thompson NL,
and
Hemler ME.
The light chain of CD98 is identified as E16/TA1 protein.
J Biol Chem
273:
33127-33129,
1998
24.
Mastroberardino, L,
Spindler B,
Pfeiffer R,
Skelly PJ,
Loffing J,
Shoemaker CB,
and
Verrey F.
Amino-acid transport by heterodimers of 4F2hc/CD98 and members of a permease family.
Nature
395:
288-291,
1998[Medline].
25.
May, WS, Jr,
Sahyoun N,
Wolf M,
and
Cuatrecasas P.
Role of intracellular calcium mobilization in the regulation of protein kinase C-mediated membrane processes.
Nature
317:
549-551,
1985[Medline].
26.
Nakamura, E,
Sato M,
Yang H,
Miyagawa F,
Harasaki M,
Tomita K,
Matsuoka S,
Noma A,
Iwai K,
and
Minato N.
4F2 (CD98) heavy chain is associated covalently with an amino acid transporter and controls intracellular trafficking and membrane topology of 4F2 heterodimer.
J Biol Chem
274:
3009-3016,
1999
27.
Novak, DA,
Matthews JC,
Beveridge MJ,
Yao SY,
Young J,
and
Kilberg MS.
Demonstration of system y+L activity on the basal plasma membrane surface of rat placenta and developmentally regulated expression of 4F2HC mRNA.
Placenta
18:
643-648,
1997[ISI][Medline].
28.
Ogura, K,
Sakata M,
Okamoto Y,
Yasui Y,
Tadokoro C,
Yoshimoto Y,
Yamaguchi M,
Kurachi H,
Maeda T,
and
Murata Y.
8-Bromo-cyclic AMP stimulates glucose transporter-1 expression in a human choriocarcinoma cell line.
J Endocrinol
164:
171-178,
2000[Abstract].
29.
Ogura, K,
Sakata M,
Yamaguchi M,
Kurachi H,
and
Murata Y.
High concentration of glucose decreases glucose transporter-1 expression in mouse placenta in vitro and in vivo.
J Endocrinol
160:
443-452,
1999[Abstract].
30.
Ohta, H,
Tsurudome M,
Matsumura H,
Koga Y,
Morikawa S,
Kawano M,
Kusagawa S,
Komada H,
Nishio M,
and
Ito Y.
Molecular and biological characterization of fusion regulatory proteins (FRPs): anti-FRP mAbs induced HIV-mediated cell fusion via an integrin system.
EMBO J
13:
2044-2055,
1994[ISI][Medline].
31.
Pfeiffer, R,
Rossier G,
Spindler B,
Meier C,
Kuhn L,
and
Verrey F.
Amino acid transport of y+L-type by heterodimers of 4F2hc/CD98 and members of the glycoprotein-associated amino acid transporter family.
EMBO J
18:
49-57,
1999[ISI][Medline].
32.
Pineda, M,
Fernandez E,
Torrents D,
Estevez R,
Lopez C,
Camps M,
Lloberas J,
Zorzano A,
and
Palacin M.
Identification of a membrane protein, LAT-2, that co-expresses with 4F2 heavy chain, an L-type amino acid transport activity with broad specificity for small and large zwitterionic amino acids.
J Biol Chem
274:
19738-19744,
1999
33.
Prasad, PD,
Wang H,
Huang W,
Kekuda R,
Rajan DP,
Leibach FH,
and
Ganapathy V.
Human LAT1, a subunit of system L amino acid transporter: molecular cloning and transport function.
Biochem Biophys Res Commun
255:
283-288,
1999[ISI][Medline].
34.
Ramamoorthy, S,
Leibach FH,
Mahesh VB,
and
Ganapathy V.
Modulation of the activity of amino acid transport system L by phorbol esters and calmodulin antagonists in a human placental choriocarcinoma cell line.
Biochim Biophys Acta
1136:
181-188,
1992[Medline].
35.
Sakata, M,
Farooqui SM,
and
Prasad C.
Post-transcriptional regulation of loss of rat striatal D2 dopamine receptor during aging.
Brain Res
575:
309-314,
1992[ISI][Medline].
36.
Sakata, M,
Kurachi H,
Imai T,
Tadokoro C,
Yamaguchi M,
Yoshimoto Y,
Oka Y,
and
Miyake A.
Increase in human placental glucose transporter-1 during pregnancy.
Eur J Endocrinol
132:
206-212,
1995
37.
Sakata, M,
Yamaguchi M,
Imai T,
Tadokoro C,
Yoshimoto Y,
Oka Y,
Kurachi H,
and
Miyake A.
8-Bromo-cAMP inhibits glucose transport activity in mouse placental cells in culture.
J Endocrinol
150:
319-327,
1996
38.
Sato, H,
Tamba M,
Ishii T,
and
Bannai S.
Cloning and expression of a plasma membrane cystine/glutamate exchange transporter composed of two distinct proteins.
J Biol Chem
274:
11455-11458,
1999
39.
Schägger, H,
and
von Jagow G.
Tricine-sodium dodecyl sulfate-polyacrylamide gel electrophoresis for the separation of proteins in the range from 1 to 100 kDa.
Anal Biochem
166:
368-379,
1987[ISI][Medline].
40.
Segawa, H,
Fukasawa Y,
Miyamoto K,
Takeda E,
Endou H,
and
Kanai Y.
Identification and functional characterization of an Na+-independent neutral amino acid transporter with broad substrate selectivity.
J Biol Chem
274:
19745-19751,
1999
41.
Tadokoro, C,
Yoshimoto Y,
Sakata M,
Fujimiya M,
Kurachi H,
Adachi E,
Maeda T,
and
Miyake A.
Localization of human placental glucose transporter 1 during pregnancy: an immunohistochemical study.
Histol Histopathol
11:
673-681,
1996[ISI][Medline].
42.
Torrents, D,
Estevez R,
Pineda M,
Fernandez E,
Lloberas J,
Shi YB,
Zorzano A,
and
Palacin M.
Identification and characterization of a membrane protein (y+L amino acid transporter-1) that associates with 4F2hc to encode the amino acid transport activity y+L: a candidate gene for lysinuric protein intolerance.
J Biol Chem
273:
32437-32445,
1998
43.
Tsurudome, M,
Ito M,
Takebayashi S,
Okumura K,
Nishio M,
Kawano M,
Kusagawa S,
Komada H,
and
Ito Y.
Cutting edge: primary structure of the light chain of fusion regulatory protein-1/ CD98/4F2 predicts a protein with multiple transmembrane domains that is almost identical to the amino acid transporter E16.
J Immunol
162:
2462-2466,
1999
44.
Tsurudome, M,
Nishio M,
Komada H,
Bando H,
and
Ito Y.
Extensive antigenic diversity among human parainfluenza virus type 2 virus isolates and immunological relationship among paramyxoviruses revealed by monoclonal antibodies.
Virology
171:
38-48,
1989[ISI][Medline].
45.
Tsurudome, M,
Yamada A,
Hishiyama M,
and
Ito Y.
Monoclonal antibodies against the glycoproteins of mumps virus: fusion inhibition by anti-HN monoclonal antibody.
J Gen Virol
67:
2259-2265,
1986
46.
Wilson, PT,
Gershoni JM,
Hawrot E,
and
Lentz TL.
Binding of
-bungarotoxin to proteolytic fragments of the
-subunit of Torpedo acetylcholine receptor analyzed by protein transfer on positively charged membrane filters.
Proc Natl Acad Sci USA
81:
2553-2557,
1984
47.
Yokota, K.
Cellular mechanism of synergistic stimulation of PGE2 production by phorbol diester and Ca2+ ionophore A23187 in cultured Madin-Darby canine kidney cells.
Arch Biochem Biophys
288:
192-201,
1991[ISI][Medline].
This article has been cited by other articles:
![]() |
S. Roos, N. Jansson, I. Palmberg, K. Saljo, T. L. Powell, and T. Jansson Mammalian target of rapamycin in the human placenta regulates leucine transport and is down-regulated in restricted fetal growth J. Physiol., July 1, 2007; 582(1): 449 - 459. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y. Yan, G. Dalmasso, S. Sitaraman, and D. Merlin Characterization of the human intestinal CD98 promoter and its regulation by interferon-{gamma} Am J Physiol Gastrointest Liver Physiol, February 1, 2007; 292(2): G535 - G545. [Abstract] [Full Text] [PDF] |
||||
![]() |
L. J. Foster, P. A. Zeemann, C. Li, M. Mann, O. N. Jensen, and M. Kassem Differential Expression Profiling of Membrane Proteins by Quantitative Proteomics in a Human Mesenchymal Stem Cell Line Undergoing Osteoblast Differentiation Stem Cells, September 1, 2005; 23(9): 1367 - 1377. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| Visit Other APS Journals Online |